KEGG   Taeniopygia guttata (zebra finch): 100219662Help
Entry
100219662         CDS       T01082                                 

Gene name
USP31
Definition
(RefSeq) ubiquitin specific peptidase 31
  KO
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.4.19.12]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100219662 (USP31)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100219662 (USP31)
Ubiquitin system [BR:tgu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100219662 (USP31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 1125 aa AA seqDB search
MQYRGNAQHDAQEFLLWLLDRVHEDLNNVVNSGGMPPLKPPLEDDVLLEGPAFPISSTFV
QELFQAQYRSSLTCPHCQKQSNTFDPFLCISLPIPLPHTRPLYVTVVYQGKCSHCMRIGV
AVPISGTVARLREAVSSETKIPTEQIVLTEMYYDGFHRSFCDTDDLDTIHESDCIFAFET
PEIFRPEGILSQRGIHVNNNLNNLKCGTEHSRTIAYSQGTVKSGKLEQSCPKLAANDKIV
LLVCNRACTGQQSKRFGLPFVLHLEKTIAWDILQKEILEKMQYFLRPAACLQVCPFSLRV
VSVVGITYLLPQEERPLCHPTVERALKSCGQGGTAHVKLVVEWDKETKDYLFVNTEEEYI
PDSESVRQQRELHHQPQICTLSQCFQLYTKEEQLAPDDAWRCPHCKQLQQGSITLSLWTL
PDVLIIHLKRFRQEGDRRMKLQNMVKFPLSGLDMTPHVVKRSQSSWSLPSHWSPWRKPYG
LGRDPEDYIYDLYAVCNHHGTMQGGHYTAYCKNSVDGQWYCFDDSEVQQLSESEVCKQTA
YILFYQRRTAIPSWSANSSVAGSTSSSLCEHWVSRLPGSKQPSVASAASSRRTSLASLSE
SVELTGERSEDDGGFSTRPFVRSVQRQSLSSRSSVTSPLAVSENGVRPLWSLSAKLQFRS
NSPSRFSGDSPVHTSASTLEKIGEAADDKVSTSCFGSLRNLSSSYLEPCDSSRREHRTAR
RAPLAVMEGAFREESVVRTSSSDLSDGYGKSSVQPDRNHPALDPFDNNNQIAFVDQSDSV
DSSPVKEAKASAGTGLAAEKVHDTPRKGHGSKGASEPDKSLRKGRTVLATQETKVSRSSP
PLKSSQKASRSRSKTDSSRVSGRHGSPAPTQARKDHSTKPLEASVPSAAQKQKSGSSPSS
TAAKKTPSGPLTKGSSSGKSRTCERSLSREGSKVSLGSDKTSVTSSSRTSSPRISHSRSD
SRPADSRHVRSSSMANLRSPNAAARSGLKRDSKSEEKGLSFFKSALRQKETRRSADLGKT
TMLSKKTGSVSSKSGSKNVLEDKPEKGGAPPASQTNANITTKEKLVSKDATSNKHSLLSS
RKSKSSQLDPGVQSPPSSGKQSADKPLKKLPSSMQVSVRPSLEPQ
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
atgcagtaccgtggcaacgcccagcacgatgcccaggagttcctgctttggctgcttgac
agagtccacgaggatttgaacaacgtggtgaattccggtggcatgcctccactcaagccg
ccactggaggatgatgtgctgcttgagggcccagcctttcccatcagtagcacttttgtg
caggaactctttcaagcccagtacaggtcctccctgacgtgccctcactgccagaagcag
agcaacacctttgaccccttcctgtgcatctcgctgccgatccctctgccgcacactcgg
ccactctacgtcaccgtggtgtaccagggcaagtgctcccactgcatgcgcatcggggtg
gccgtgcccatctccggaacagtggccaggctgcgggaggctgtctcctcggaaaccaag
atacccacggagcagatcgtgctgacagagatgtactacgatgggttccatcgctccttc
tgcgacacggatgacttggacaccatccacgagagtgactgcatttttgcctttgagacc
ccagagatcttcaggcctgagggcatcctcagtcagagaggaatacatgtgaacaataac
ctgaataacttgaaatgtggcactgagcactcccgaacaatagcttactctcaaggaacg
gtgaagtctggaaaactggagcagtcctgtcctaaactagcagcaaatgacaagattgtc
ttgctggtgtgtaacagagcgtgcactggacagcagagcaaaaggtttggcttgcccttt
gtgttgcacttggaaaaaacaattgcttgggatattctgcagaaggaaatactggagaag
atgcagtatttcctgcggcctgcagcctgcttgcaggtttgcccattcagcttgcgagtg
gtcagtgttgtgggcataacatacttgctacctcaggaggagcgacccctctgccaccca
accgtggaaagggcattgaagtcatgcggacaggggggaactgctcatgtgaaattagtg
gtagaatgggacaaagaaactaaagattacttgtttgtgaatacagaagaggaatatatt
ccagactctgaaagcgtccgccagcagagagagcttcatcatcaacctcagatctgcact
ttatctcagtgtttccaactgtacaccaaagaggaacagcttgccccagatgatgcatgg
cgatgcccacactgtaagcagctgcagcagggtagcatcacactgagcctctggacctta
cctgatgttctcatcatacatctcaaaaggtttaggcaggaaggagaccgaaggatgaaa
cttcagaacatggttaaatttcccttgagtggtttggatatgactcctcacgttgtgaaa
cgcagccagagcagctggagcttgccatcgcactggtcaccttggaggaaaccttacggc
ctcggcagagatcctgaggactacatttatgacctgtacgctgtctgcaaccaccatggc
accatgcaaggcggacattatacagcatattgcaagaattctgttgatggccagtggtac
tgcttcgatgacagtgaagttcagcaactttctgagagtgaagtctgcaagcagaccgct
tatatcttgttctaccagcgacgcacagcgatcccctcgtggtctgccaacagttccgtg
gcaggctccacgagctcgtcgctgtgcgagcactgggtcagccggctcccgggcagcaag
cagcccagcgtcgcctcggccgcctcctcgcgccgcacctcgctggcctcgctctcggag
tccgtggagctgaccggggaacgcagcgaagatgacggaggattttcaactcgaccgttt
gtaaggagtgtccagcgtcagagtttgtcatccagatcctctgtcaccagcccactggca
gtgagtgaaaatggtgtcaggcccttgtggtcactctctgcaaaactgcagttccgctcc
aactccccatcacgcttctctggagattccccagtacatacctctgcttccactctggag
aagattggggaagctgctgatgataaagtttccacctcgtgctttggcagcctgaggaat
ctctctagcagctacttggagccctgtgacagcagtcggcgagagcacaggacagctcgc
agagcccctctggctgtaatggaaggggcgttcagggaggagtccgttgtaaggacatct
agctcagacctttcagatgggtatggtaaaagctctgtgcagccagacaggaatcaccct
gctctggacccttttgataacaacaatcaaatcgcctttgttgaccagagtgattctgtg
gacagctccccagtgaaggaggcgaaagcctcagctgggacagggctggctgcggagaag
gtacatgacacccctaggaagggtcacggctccaaaggagcttctgagccagacaaaagt
ctgaggaagggaaggacagtcttagctacccaagagaccaaagtctctcgctcttctcct
ccactgaagagttcccagaaagcttctcggtctagaagtaagacagactcctctagggtc
agcgggcgacacgggtctcctgctcccacgcaagctaggaaggaccacagcacaaagccc
ctggaggcatctgtcccttcagctgcacagaagcagaagtcaggttcttctccatcctcc
acggctgccaagaaaaccccatcaggcccattgactaagggctcttcctcggggaagagc
cggacttgcgagcgcagcctcagccgggagggctccaaggtcagtctggggtcggacaag
acgagcgttaccagcagctccaggacgagctccccgcggatcagccactcccggagcgac
agcaggccggcggacagcaggcacgtgcgcagctcctccatggccaacctgcgctcccca
aacgctgcggcgcgctccggcttgaagagggacagcaagtcggaagagaagggtttgtct
ttctttaaatcggccttaaggcagaaggagacgcggaggtcggcagacctgggcaagaca
acaatgctttcaaaaaagacagggagtgttagttccaagtcaggcagtaaaaatgtgctg
gaggacaaaccagagaaaggtggtgccccaccagcctctcaaaccaatgccaacatcact
acaaaagaaaaacttgtctcaaaagatgccacatctaacaaacattctctgttatccagt
cgcaagtccaagtcttcccagctagatcctggagtccagtctcctccttccagtggcaag
cagtctgctgacaagccgctgaaaaaattaccttccagcatgcaggtgtctgtacggcct
tctctggaacctcagtga

DBGET integrated database retrieval system