KEGG   Taeniopygia guttata (zebra finch): 100219694Help
Entry
100219694         CDS       T01082                                 

Definition
alcohol dehydrogenase 1-like
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100219694
  Lipid metabolism
   00071 Fatty acid degradation
    100219694
  Amino acid metabolism
   00350 Tyrosine metabolism
    100219694
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100219694
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100219694
   00982 Drug metabolism - cytochrome P450
    100219694
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100219694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 374 aa AA seqDB search
MATAGKVIRCRAAVAWAPGKPLSVEEVEVAPPKAGEVRIKIVATSICHTDDHVLKGSLQK
VEFPVIPGHEGAGIVESIGQGVTSVKPGDKVIPLCLPQCGECSFCQNPESNYCQKTHFSE
PQNLLPDKTSRFTCKGKQIHHYLWISTFAEYTVVPEYAVAKIDAAAPLDKVCLIGCGFST
GYGAAINTAKVKPGSTCAIFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKARELGAT
DCINPRDFKKPIQEVLTEMTGQGVNYSFEAIGHADTMIAALASCNASTGVCVMVGVLNSE
ISIDPVLLLTGRTWKGTLLGGWKTRECIPKLVSSYLEGKFNSDLLITHTLPFAKVNEGFE
LLRAGKSIRTVLLF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggccactgcgggaaaagttatcaggtgcagggctgctgttgcctgggccccaggcaaa
ccactgtctgttgaggaggtggaagttgcacccccaaaggcaggagaagtccggatcaag
attgtggccacaagcatctgtcacacagatgatcatgttttgaaaggatctttgcaaaag
gtggaattcccagttatccctggccatgaaggagctgggattgtggaaagcattggacaa
ggagtgacctctgtgaaaccaggagacaaagtgatcccactttgcctccctcagtgtggg
gaatgcagcttctgccagaatcctgaatccaactactgccagaagacccatttctctgaa
ccacaaaacctgctgccggacaagaccagccgcttcacttgcaaagggaagcagatccac
cactacctgtggatcagcacctttgcagaatacactgtggtcccagaatacgccgttgcc
aagatagatgctgcggcacctctggacaaagtctgcttgatcggctgtgggttttccaca
ggctatggggctgccatcaacacagccaaggtaaaaccaggctccacctgtgccatcttt
ggcctcggaggagttggcctctctgttgtcatgggctgcaaggcggctggagctgcccgc
atcattgccgtggacatcaacaaggacaagtttgccaaggccagggagctgggagccact
gactgcatcaaccctcgagacttcaagaagcccatccaggaggtgctcactgagatgacc
gggcagggtgtgaactactcctttgaggccatcgggcacgcggacaccatgattgctgcc
ttggcttcctgcaatgccagcactggtgtctgtgtgatggttggggtgcttaattcagag
atttccattgatcctgtgcttctgctgactgggcgtacatggaaggggactttgcttgga
ggctggaagacgagagaatgtatccccaaattagtttccagctacttggaggggaaattc
aattcagacttgctgatcacgcacacgctgccattcgctaaagtgaacgagggatttgag
ttgttacgtgcaggaaaaagtatccgcactgtcctgctcttctga

DBGET integrated database retrieval system