KEGG   Taeniopygia guttata (zebra finch): 100219695Help
Entry
100219695         CDS       T01082                                 

Gene name
MTOR
Definition
mechanistic target of rapamycin (serine/threonine kinase)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
ErbB signaling pathway
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100219695 (MTOR)
   04150 mTOR signaling pathway
    100219695 (MTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100219695 (MTOR)
   04920 Adipocytokine signaling pathway
    100219695 (MTOR)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [Table]
   100219695 (MTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
21
AA seq 2521 aa AA seqDB search
MSGTVSILQQFANGLKSRSEETRAKAAKDLQHYVTMELREMSQEESTRFYDQLNHHIFEL
VSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLA
MAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNI
FVAVWDPKQAIREGAVSALRACLILTTQREPKEMQKPQWYRHTYEEAEKGFDETLAKEKG
MNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMGFSTKPRHIT
PFTSFQSLQPSQSNALAGLLGYSAHQGIMGFATSPIPVKSTLVESRCCRDLMEEKFDQVC
QWVLKCRTSKNSLIQMTVLNLLPRLAAFRPSAFTADQYLPDTMNHVLSCVKKEKERTAAF
QALGLLSVAVRSEFQAYLPKVLEIIKAALPPKDFAHKRQKSVQVDATVFTCISMLARAMG
PSIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRH
PGMPKGLAHQLASPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSE
HKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRFC
VLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKML
IQILTELEHSGVGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALIVKLKDPDPDPNPGV
INNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVALWTLGQLVASTGYV
VEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASA
VSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSQHHTMVVQA
ITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVRSHIRPYMDEI
VTLMRDFWVMNNSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSQGRIVSV
KLLNAIQLFGANLDDYLHLLLPPIVKLFDAPDVPVVARKAALETVDRLTESLDFTDYASR
IIHPIVRTLDQSPELRTTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLIC
RIVKGYTLADEEEDPLIYQHRMLRSNQGETLPSGPVETGPMKKLHVSTINLQKAWGAARR
VSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQ
DELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYA
KALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLH
EWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTQVNDETQAKMAR
MAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAE
LTAMAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQ
RILMVRSLVVNPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHP
QVTYAYMKHMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKL
GEWQLNLQGINESTIPKVLQYYSAATEHDRNWYKAWHAWAVMNFEAVLHYKHQNQARDEK
KKLRHASGASITSANTEGSNSESDAESTENSPIPSPVQKKVTEDLSKTLLMYTVPAVQGF
FRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDT
PRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQ
AMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKET
SFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSP
KLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKG
HEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHA
LIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSP
SSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTR
EKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLN
WRLMDTNTKGNKRSRTRTDSYSTSQSVEMLDSVELGETAHKKTGTTVPESIHSFIGDGLV
KPEALNKKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPF
W
NT seq 7566 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcactgtgtccattctccagcaatttgccaatggcttgaagagtcgcagcgag
gagacaagggcaaaagctgccaaggacttgcagcattatgtcaccatggagctgcgtgag
atgagtcaggaagaatctaccaggttttacgatcagctgaaccatcacatatttgagctg
gtctctagctctgatgcaaatgaaaggaagggtggcattctggctatagcaagtcttatc
ggcgttgaaggaggcaatgccacccgtatcggcaggtttgccaactacctgaggaacctc
ttgccatccaatgaccctgttgtaatggagatggcttccaaggctattgggcggcttgca
atggctggtgacaccttcacagctgagtatgtggagttcgaggtgaaacgagctctggaa
tggctgggagctgacaggaatgaaggtcgtagacatgcagctgttcttgtcttgcgggag
ctggcaatcagcgtgcctaccttcttcttccaacaagtgcagccgttctttgacaatata
tttgtggctgtgtgggatcccaaacaggccatccgagagggagctgtctctgccttaaga
gcctgccttatccttaccacgcaacgggagccaaaagagatgcagaagccccagtggtac
agacatacatatgaagaggctgagaagggctttgatgagactttggccaaagagaaagga
atgaatcgtgatgaccgaatccacggtgccttactgatcctcaatgagctagtgagaatc
agcagtatggagggagagcgccttagagaggagatggaggagatcactcagcagcagctt
gtgcatgacaagtactgcaaagacctcatgggcttcagtaccaaacctcgccacatcact
cccttcacaagctttcagtctcttcagccctctcagtcaaatgctttggctggtctcctg
gggtacagtgctcaccagggaattatggggtttgcaacctcacctatcccagtaaaatct
actttggtagaaagtcgatgctgcagggatctaatggaagagaaatttgatcaagtctgc
cagtgggttctcaagtgcagaaccagcaaaaattctttgatccagatgacagttctcaat
ctgctaccacgattggcagctttccgtccttcagcgttcacagctgatcagtatcttcca
gacaccatgaatcatgttctcagttgtgtgaagaaggagaaggagcgaacagcagccttc
caggccttgggtttgctttctgtggcagtgaggtctgagtttcaagcttacctaccaaaa
gtccttgaaatcataaaagcagctcttcccccaaaggactttgcccacaagagacagaag
tctgtgcaggttgatgccacagtcttcacctgcattagtatgctggcacgagccatggga
cccagtatccagcaggacatcaaagagcttttggaacctatgctggctgtgggcctgagc
cctgctctgacagctgtgctgtatgatttgagccgtcagatcccacagctgaagaaggat
atccaggacgggctgctgaaaatgctctctcttgttctgatgcacaagcctctgcgacat
ccaggcatgccaaagggccttgcccaccagctggcctcccccagtctcaccaacatccca
gaggccagtgatgtggggagcatcacccttgccctgcgtacactcggtagctttgagttt
gaaggccactccctgactcagttcgttcggcattgcgcagatcacttcctgaacagcgaa
cacaaggagatccgcatggaagcggcccgcacttgctctcgcctgctcacaccctccatc
cacttgatcagtggtcatgcccatgtggtcagtcagacagcagtgcaggtcgtggctgat
gtcctcagcaaactgcttgtagttggaataactgacccagaccctgatatacgtttctgt
gtgttggcttctctggatgagcggtttgatgctcaccttgcccaggctgaaaacttgcaa
gctctttttgtggccctgaatgatcaagtgtttgaaatccgagagctggccatctgcact
gtggggcgcctgagcagcatgaaccctgcctttgtcatgcctttccttcggaagatgtta
atccagattctaacagagctggagcacagcggtgttggcagaatcaaagagcaaagtgcc
aggatgttgggtcacctggtttctaatgctccacgcctcatccgtccctatatggagcct
atccttaaggcactgattgtgaaactgaaagatcctgatccagatcccaatccgggcgtg
attaacaatgtcctggctactataggggagcttgcacaggtcagtgggctggagatgagg
aagtgggtggatgagctcttcattataattatggacatgctacaggactcctccctgctg
gctaaaagacaagtggctctttggacactggggcagcttgtggctagcactggttatgtg
gtagaaccatacaggaagtacccaactttgctggaggtgcttctgaacttcctgaagact
gaacaaaaccagggcacccgcagagaggctattcgtgtgttagggctgctgggtgctttg
gacccttacaaacacaaagtgaacattggcatgattgatcagtcacgagatgcttcagct
gttagcctctcggagtccaaatccagccaggattcttctgactacagcaccagtgagatg
ttggtgaacatgggcaacctccctctggatgagttctatccagctgtctctatggtggca
ctgatgagaattttccgagaccaatccttgtcccagcaccacactatggtagttcaggcc
atcacctttattttcaaatcccttggactgaagtgtgtgcagttcctgccccaggtcatg
cccacgttccttaatgtaatacgggtgtgtgatggtgccatccgagagttcctgttccag
cagctaggaatgttggtgtcctttgtgagaagtcatattcggccctatatggatgaaatt
gtcaccctgatgagagacttctgggttatgaacaactccatacagagcacaattatcctg
cttattgagcagattgtggtggctctaggaggcgaattcaaactttacctgcctcagctc
attcctcacatgttacgggtcttcatgcatgacaacagtcagggtcgcattgtttctgtg
aagctgcttaatgcgatccagctctttggagctaacctggatgactaccttcatttgtta
ctacctcccattgtaaagctatttgatgccccagatgtccctgtggtggctcgcaaagct
gctctagaaacagtggaccgcttgacagagtccctggatttcacagattatgcatcacgg
attattcatcccatcgtacgaacactagatcagagccctgagctacgaacaactgcaatg
gacaccctctcctctctggtgttccagctgggaaagaagtaccaaatttttatcccgatg
gtgaacaaagtcctggtgcgacacagaattaaccatcaacgctatgatgttctcatctgc
agaattgtaaagggttacactcttgctgatgaagaagaggatcccctgatttatcagcat
cgaatgttgagaagcaaccagggagaaactttgcccagtggtcctgtggaaacaggtccc
atgaaaaaattacatgtgagcaccatcaacctgcagaaggcctggggagcagcaagaaga
gtttccaaggatgactggttggagtggttaaggaggctgagtttggagctgctgaaagat
tcttcctccccatccctgcgctcgtgttgggccctggctcaagcctataatcccatggct
cgagacctcttcaatgctgcttttgtttcatgttggtctgaactgaatgaagaccagcag
gatgagctgatccgaagcattgagttggccttgacatctcaggatattgcagaagtcact
cagactcttctgaacttggcagaattcatggagcacagtgacaagggcccactgcctttg
agagatgacaatggcattgtccttctgggggaaagagctgccaaatgtcgagcatatgct
aaggcccttcactacaaagagctggaatttcaaaaaggtcccaccccagctattctagag
tctctcatcagcattaacaataaactccagcagccagaagcagctgctggtgtgctggaa
tatgccatgaagcactttggggagctggaaattcaagctacctggtatgaaaagcttcat
gaatgggaagatgctctggtggcctatgacaagaagatggacacaaacaaagatgatcct
gagctgatgctgggacggatgcgctgcttggaagcacttggtgaatgggggcaactccac
cagcaatgctgtgaaaagtggacccaggtgaatgatgaaactcaagccaagatggccagg
atggctgctgctgctgcttggggcctgggtcagtgggacagcatggaagaatacacctgc
atgatccccagggacacccatgatggtgctttctacagggctgtactggcactgcatcaa
gaccttttctcactggctcagcaatgcattgacaaagccagagacctgctggatgctgag
ctgactgccatggcaggagagagttacagtcgagcctatggggctatggtatcctgccag
atgctgtcagagctggaagaggttatccagtataaacttgtaccagagcgccgtgagatc
atccgccagatctggtgggaaaggctgcagggctgtcagcggatcgtggaagactggcag
agaatattgatggtccgatctcttgttgtgaatcctcatgaggacatgagaacttggctc
aagtatgccagcttgtgtggcaagagtgggaggctggctttggcccataagacccttgtc
ctgctcttgggagtagatccatctcgccagctggatcacccactgcccacagtccatccc
caagtgacttatgcatacatgaagcacatgtggaagagtgcccgtaagatcgatgcgttc
cagcacatgcagcactttgtgcagaccatgcagcagcaggcccagcacgccatcgccacc
gaggaccagcagcacaaacaggagctccataagctcatggcacggtgtttcctgaaactg
ggtgagtggcagctgaacctgcaaggcatcaatgagagcaccatccccaaagtcttgcaa
tactacagtgctgcaacggagcatgatcgcaactggtacaaggcctggcatgcctgggca
gtgatgaactttgaagcagtgcttcactataaacaccaaaaccaagctagagatgagaag
aagaaactccgtcacgcgagcggagccagcatcaccagcgctaacactgagggcagcaac
agtgagagtgatgcagagagcactgagaacagtcccatcccatccccagtgcagaaaaaa
gtcactgaggatttatccaagaccctcttgatgtacacagtccctgctgtccagggtttc
ttccgatccatttctctgtctcgaggaaacaacctgcaagacactctaagagtccttacc
ctgtggtttgactatggtcattggcctgatgtgaatgaggctttggtagaaggagtcaag
gcaatccaaatagacacttggctgcaggttatccctcagctcattgccagaattgacacc
cctcgaccactggtaggacgcctcattcaccagctgctcacggacattggtcggtaccac
ccccaggctttgatctatcctttgactgtggcttctaaatctacgaccactgctcggcac
aatgctgcaaataagatcttgaaaaacatgtgtgagcatagcaacactctggtgcagcag
gcaatgatggtgagtgaagagctaattcgtgtggccatcctatggcacgagatgtggcat
gaagggttggaagaagcatctcgtctgtattttggagaaagaaatgtaaagggaatgttt
gaggtgctggaaccacttcatgcaatgatggagagagggcctcagactttaaaggagaca
tccttcaatcaggcctatggcagagatctcatggaagctcaggagtggtgcaggaagtat
atgaaatcaggaaatgtcaaagacctaactcaggcttgggatctctattatcacgtgttc
cgacgtatctcaaagcagctgccacagctcacttctttggagctacagtatgtgtcacca
aaactcttaatgtgccgggatctggaattggcagtgccaggaacgtatgatcccaaccag
cccatcatacggattcagtccatcgcaccgtcactgcaggtcatcacctccaagcagcga
cccaggaagttgacgttaatgggaagcaatgggcatgagtttgtattccttctgaaaggt
cacgaagaccttcgccaagatgaaagagtgatgcagctttttggtttggtcaacactctg
ttagcaaatgacccaacttctcttcgtaaaaacctcagcatccagagatatgctgttatt
ccactgtctacaaattcaggcttaattggctgggtgccccactgtgacacgctgcacgca
ctcatccgagactacagagagaagaaaaagatcctgctcaacattgagcatcgcatcatg
ctgaggatggctccagactatgaccacctgactctgatgcagaaagtagaagtatttgaa
catgctgtcaataacacagcgggggatgaccttgccaaactgctgtggttgaaaagtcca
agctcagaggtatggtttgacagaagaacaaattacacccgttctctagctgtgatgtca
atggttgggtacattttgggcctcggggacagacacccttccaatttgatgttagacaga
ctaagtggaaagatcctgcacatcgactttggagactgttttgaagttgcaatgacaaga
gaaaagttccctgagaagattccatttagattaacaaggatgctgacaaatgctatggag
gtgacaggcctcgatgggaactatagaatcacctgtcatacagtgatggaagtgctgcgt
gaacacaaggacagtgtcatggctgtgctggaagcctttgtgtatgatcccttgctgaac
tggagattgatggacacaaatacaaagggcaataagcgctcacgaacaagaacagactcc
tactcaaccagtcagtcagtagaaatgttggacagtgtggaattgggtgagacagctcat
aaaaaaactggaaccacagtgcctgaatccatccattccttcataggagatggtctggtg
aagccagaagctctaaataagaaggcaattcagatcatcaacagggttcgagataagctc
actggtcgagacttctctcatgacgaaactctcgatgtacccacacaagtagaactgctc
attaaacaagcaacttctcatgagaatctgtgccagtgctacattggatggtgtcctttc
tggtaa

DBGET integrated database retrieval system