KEGG   Taeniopygia guttata (zebra finch): 100219724Help
Entry
100219724         CDS       T01082                                 

Gene name
MAP2K5
Definition
mitogen-activated protein kinase kinase 5
Orthology
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
Gap junction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100219724 (MAP2K5)
 Cellular Processes
  Cell communication
   04540 Gap junction
    100219724 (MAP2K5)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100219724 (MAP2K5)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100219724 (MAP2K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 365 aa AA seqDB search
MEYYSTVMEQQVNGQLIEPLQIYPRACKPPGKRNIHGLKVNTRAGAAGSGAAATSEALPS
NSLKKSSAELKKILANGQMNEQDIRYRDILGHGNGGTVYKAYHVRSGKILAVKVIPLDIT
LELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISLCTEFMDGGSLDVYRKIPEHVLGR
IAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAY
MAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQKNQGSLMPLQLLQCIVDEESPV
VPAGEFSEPFVHFITQCMKKQPKERPAPEDLMGHPFVVQYNHGHAEVVSMWVCRMLEERR
APGPP
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggagtattactccacggtgatggagcagcaggtgaatggacagctgatagagcctctc
cagatctacccacgagcctgcaaacctcctgggaaacggaacatacatggcctcaaggtg
aacacgcgggcgggggccgccggcagcggcgccgcggccacctccgaggccctgcccagc
aacagcctgaagaaatcctctgcagagctgaagaagatccttgccaatggccagatgaat
gaacaagacattcgataccgagacatcctcggccacggcaacggcggcaccgtctacaag
gcttaccatgtccgtagtggaaaaatcctggcagtgaaggtcatacccttggacataaca
ctggagctccagaagcagatcatgtcagagttagaaattctttacaagtgtgactcctcg
tatatcataggattttatggtgctttttttgtagaaaacaggatttcattgtgcacagag
ttcatggatggggggtctctggatgtttacaggaaaattccagaacacgttcttggaagg
atagcggtggctgttgtgaaaggcctgacctatttatggagcctgaagattttacacaga
gatgtgaagccctccaatatgctggtgaacacccgtggccaggtgaagctctgtgacttt
ggggtcagcacccagctggtgaattccatagccaagacgtatgttggaacaaatgcttat
atggcgcctgagaggatttcgggggagcagtacgggattcactcggatgtttggagcctg
gggatttccttcatggagcttgctcttgggaggtttccatatcctcagattcagaaaaac
cagggatctttaatgcctctccagttattgcagtgcattgttgatgaggaatcgccggtg
gttccagccggggagttctcggagccatttgtgcacttcatcactcaatgcatgaagaag
cagccaaaggagaggccagcacctgaagatttaatgggccaccccttcgtggtgcagtac
aaccacggccacgccgaggtggtgtccatgtgggtgtgccggatgctggaggagcggcga
gccccgggacccccgtga

DBGET integrated database retrieval system