KEGG   Taeniopygia guttata (zebra finch): 100219801Help
Entry
100219801         CDS       T01082                                 

Gene name
MAP2K4
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
tgu04012  ErbB signaling pathway
tgu04620  Toll-like receptor signaling pathway
tgu04912  GnRH signaling pathway
tgu05164  Influenza A
Module
tgu_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100219801 (MAP2K4)
   04012 ErbB signaling pathway
    100219801 (MAP2K4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100219801 (MAP2K4)
  Endocrine system
   04912 GnRH signaling pathway
    100219801 (MAP2K4)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100219801 (MAP2K4)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100219801 (MAP2K4)
Protein kinases [BR:tgu01001]
 Serine/threonine kinases: STE group
  STE7 family
   100219801 (MAP2K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase DXP_redisom_C APH Choline_kinase
Motif
Other DBs
NCBI-GeneID: 100219801
NCBI-ProteinID: XP_012433949
Position
18
AA seq 444 aa AA seqDB search
MRDGPADVRAPPAEGLAVPSAERGPLRVMPPARGSSRGAAGPPGDAPGDAAPPPPRRNGA
AGAGPRRGGVSRPQPGADGRRGRVSCPAGEGPAHRRRRCSRSAHNGDSHPQRRLRGERDR
GKRKALKLNFANPPFKSTARFTLNTSGVPFQNPHIERLRTHSIESSGKLKISPEQHWDFT
AEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDC
PYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNH
LKENLKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPS
ASRQGYDVRSDVWSLGITLIPRSPNYLSAFFSLTKDESKRPKYKELLKHPFILMYEERTV
DVACYVCKILDQMPATPSSPMYVD
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcgagacggaccagcagatgtccgggcgccgccggctgaggggctggcggtgccgagc
gcggagcggggtcccctgcgggtgatgcccccggcccgagggagcagccgcggagccgca
ggaccgcccggggatgcccccggtgatgcagcgccgcctccgccccggcgcaacggagcc
gcaggcgcggggccccggcggggaggggtttcgcggccccagccgggggcggacgggcgg
cggggccgtgtgtcctgccctgccggggagggccctgcgcatcgccgccgccgctgctcc
cgctccgcgcacaatggcgactcccacccccagcggcggctccggggggagagggatcgg
ggtaaacgcaaagcgctgaagttaaattttgcaaatccacctttcaagtccacagcaaga
tttactctaaatacttctggagttcctttccaaaatccacacatagagagactgagaaca
cacagcattgaatcatcaggaaaattgaagatttcccctgagcaacattgggattttaca
gcagaggacttgaaagaccttggagaaattggacgaggcgcttatggttctgtcaacaaa
atggtccacaaacccagtgggcaaattatggcagttaaaagaattcggtcgacagtggat
gaaaaggagcagaagcagcttctgatggaccttgatgtagtgatgagaagcagtgactgc
ccgtatattgttcagttttatggcgcgctcttcagagagggtgactgttggatctgtatg
gagctcatgtctacctcgtttgataagttttacaaatatgtatatagtgtattagatgat
gttattccagaagaaatcttaggcaaaatcactttagctactgtgaaagcactaaaccac
ttaaaagaaaacttgaaaatcattcacagagacatcaaaccttccaatattcttctggac
agaaatgggaatattaaactctgtgactttggcattagcggacagctcgtggactccatt
gccaaaacgcgggatgcaggctgccggccctacatggcgcccgagaggatagaccccagc
gcctcgcggcagggctacgacgtgcgctccgacgtctggagcctgggcatcacactgatc
ccacgttctcctaattatctctctgctttctttagccttacaaaggacgagtccaaaagg
ccaaagtacaaagagcttctgaaacatcccttcatcctgatgtatgaggaacgcacagtg
gatgttgcatgctatgtttgtaaaatcctggatcaaatgccagcaactcccagctctcca
atgtacgtggattga

DBGET integrated database retrieval system