KEGG   Taeniopygia guttata (zebra finch): 100219812Help
Entry
100219812         CDS       T01082                                 

Gene name
HAT1
Definition
histone acetyltransferase 1
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100219812 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 408 aa AA seqDB search
MAGLTAMENKLAEYKCNTNEAIQLKLVRFPEDLEDENTTFNPEYSHQVFGDDEVAFGYKG
LKILLYYIAGNLSTLFRIEYTSKVNEKFDCVEADDVESKIREIIPPGFCTNTDDFVSLLE
KEVNFKPFGMLLHTYSIHNEEAGEDIIYQIYKADMTCPGFREYHERLQTFLMWFIETASF
IDVDDERWNYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILPPFQGEG
HGAQLLETIHRYYMSSPTVLDITAEDPSENYVKLRDFVLVKLCQDLLCFSPVKLMQGFSQ
EMVTEAQQKLKINKQHTRRVYEILRLRATNMGDAEQSRSYRLDVKRRLIGPYKKKQRELA
KMRRCLRPEEMTNQLNQIDLNLQREQLEESFQQLVSDYRRVLERLAQA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacttactgctatggagaataagctggctgaatacaagtgtaatacaaatgag
gcaattcagctgaagctagttcgctttcctgaggatttggaggatgagaacacaacattt
aatccagagtacagccatcaagtgtttggagatgatgaagttgcttttggctacaaggga
ctcaagatcctcttgtattacattgctggaaacctctcaaccctcttccgcattgaatac
acgtcaaaagtcaatgaaaagtttgactgtgtggaggcagatgatgtggaaagtaaaatt
agagaaatcattccgcctggtttttgcacaaatacagatgactttgtgtctctgctggag
aaagaggtcaacttcaagccctttggaatgctgttgcacacatattctattcataacgag
gaagctggtgaagatataatatatcagatatacaaggctgacatgacatgtccaggcttt
cgagaatatcatgaaaggcttcagacgttcttgatgtggtttattgaaactgctagcttt
attgatgtagatgatgaaagatggaactactttctagtatttgagaagtataataaggat
ggagctacgctctttgcgaccgtaggctacatgacagtctataattactatgtgtaccca
gacaaaacccggccacgtgtaagccagatgctgatcttgccgccattccaaggagaaggc
catggtgctcaactgcttgaaacaattcatagatactatatgtcttctcctacagtactt
gatataacagctgaagatccatctgagaactacgtgaagcttagagactttgttcttgta
aagctctgtcaagatttgctttgcttttccccagtaaagttaatgcaaggtttcagtcaa
gaaatggtgacggaagctcaacaaaaattgaaaataaataagcaacacacaagacgagtt
tatgagattctccgattgcgtgcaacaaatatgggtgatgcagaacagtccagaagctat
cgcttggatgttaaaagaagactgattgggccctataagaaaaaacagagagaacttgcc
aagatgagaaggtgtctaagaccagaggagatgactaatcagttgaaccaaatagaccta
aacttgcaacgtgaacagttagaagagagcttccaacagcttgtttcagattaccgaaga
gtcctagaacgacttgcacaagcatga

DBGET integrated database retrieval system