KEGG   Taeniopygia guttata (zebra finch): 100219847Help
Entry
100219847         CDS       T01082                                 

Gene name
HDAC7
Definition
histone deacetylase 7
Orthology
K11408  
histone deacetylase 7 [EC:3.5.1.98]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100219847 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LGE22
AA seq 682 aa AA seqDB search
MDLRIGQRVVKPXKDTALLALKQQQLQHQLFLASLHXQAVEQLGHQHVSTVPLSLAPSLE
PAERLALPGQHKPLGRTRSEPLPPSPRAVQQHLLFQQHHAHFLRQQPLLGKRPAKSSEKP
RLRQIPSSEDMEAEGTLPEAEPGDPPRARPEPPRPGGSAKEPERTQKMGHPPEGGVLCPQ
ALLWDSFQRVQQQLLKRQPLADPPVLPPGHRPLSRAQSSPATATVSLPAQDTKALALPVQ
EQPPKPLFTTGTATPAELSLLGGQEGTXGNHPEHAGRIQSIWSRLQERGLRSRCECLRGR
KATLEELQSVHSERHVLLYGTNPLNRLKLDNGKLAGILSQRTFVMLPCGGLGVDSDTIWN
ELHSSNAARWAAGSVTELAFKVATRELKNGFAVVRPPGHHADPSTAMGFCFFNSVAIAAR
QLQQKGKLSKILIVDWDVHHGNGTQQIFYRDPEVLYISLHRHDDGNFFPGSGAADEVGAG
PGEGFNVNVAWAGGLDPPMGDPEYLAAFRTVVMPIAHEFCPDVVLVSAGFDAAEGHPPPL
GGYKVSAKCFGYMTKQLMSLAGGAVVLALEGGHDLTAICDASEACVSVLLGHEPEPLPED
SLRQKPNANAVRSLEAVIQVQSKYWVAVQRFASKLGCSFLEAQHHEADEVETVTALASLS
VAVMVEKRAQEEPMEQEEPMTQ
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcggatcgggcagcgcgtggtcaagcccnncaaggacacggcgctgctggcc
ctgaagcagcagcagctgcagcaccagctcttcctggccagcctgcacncacaagcagtg
gagcagctcggccaccagcacgtcagcaccgtgcccctgtcgctggcgccgtcgctggag
ccggcggagcgcctggcgctgccgggccagcacaaaccgctgggcaggacccgctcggag
ccgctgccgcccagcccgcgcgccgtgcagcaacacctgctcttccagcagcaccacgcg
catttcctgcgccagcagccgctcctgggcaagcgcccggccaagtccagcgagaagccc
cggctgcggcagatcccctcctcggaggacatggaggccgaggggaccctcccggaggcc
gagcccggggaccccccccgggcacggccggagcccccccggcccggcggcagcgccaag
gagcccgagaggacacagaagatggggcatcccccggaaggaggtgtcctgtgtccccag
gccctgctctgggactccttccagcgggtgcagcagcagctcctcaagcgccagcccttg
gccgacccccccgtgctcccccccggccaccggcccctgtccagggctcagtcgtccccg
gccacggccaccgtgtccctccctgcccaggacaccaaggcgctggccctgcccgtgcag
gagcagccgcccaagccgctcttcaccacaggtacggccacacctgcggagctgtcactg
ctggggggacaggaggggacctgaggcaaccaccccgagcacgccgggaggatccagagc
atctggtcccggctgcaggagcggggcctgcgcagccgctgcgagtgtctgcggggccgc
aaggccaccctggaggagctgcagagcgtccacagcgagcgccacgttctcctctacggc
accaaccccctcaaccgcctcaagctggacaacggcaagctggcagggatcctgtcccag
aggacgttcgtgatgctgccctgcggagggctgggggtggacagtgacaccatctggaac
gagctgcactcgtccaacgctgcccgctgggccgccggcagcgtcaccgagctggccttc
aaggtggccaccagggagctgaagaacggctttgccgtggtgcggccgcccggacaccac
gcggatccttccacggccatggggttctgcttctttaactcggtggccatcgctgccagg
cagctgcagcagaaggggaagctcagcaagatcctcatcgtggactgggacgttcaccac
ggcaacgggacccagcagattttctacagggaccccgaggttctctacatctccctgcac
cgccacgacgacggcaacttcttcccgggcagcggcgccgccgacgaggtgggcgctggc
cccggcgagggcttcaacgtcaacgtggcctgggctggagggctggacccccccatgggg
gaccccgagtacctggctgccttcaggaccgtggtgatgcccatcgcccacgagttctgc
cctgacgtggtgctggtgtcggccggcttcgacgcagccgagggccacccgccccccctg
gggggctacaaagtctctgccaagtgttttggctacatgaccaagcagctgatgagcctg
gccgggggggccgtggtgctggcgctggagggggggcacgacctcacggccatttgtgac
gcgtccgaggcctgcgtgtccgtcctgctgggccacgagccggagccgctccccgaggac
agcctgaggcagaagcccaacgccaacgctgtgcgctcgctggaggccgtgatccaggtc
cagagtaaatactgggtggccgtgcagcgcttcgcctccaagctgggctgctccttcctc
gaggcccagcaccacgaggccgacgaggtggagacggtgacggccctggcgtccctctcg
gtggccgtgatggtggagaagagggcacaggaggagccgatggagcaggaggagcccatg
acccagtga

DBGET integrated database retrieval system