KEGG   Taeniopygia guttata (zebra finch): 100219962Help
Entry
100219962         CDS       T01082                                 

Gene name
CLK2
Definition
CDC-like kinase 2
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 766 aa AA seqDB search
MPHSRRYRSSERSSRGSYHERYRSRKHKRRRTRSRSSSSERDRRHRREDSYHVRSRSYDD
HSADRRAYDRRYCDSYRRNDYSRERGDAYYEPEYRHSYEYRRSRDREGSYRSCKSSRRKH
RRRRRRSRSFSRSSSQRSRQSSRRAKSVEDDDEGHLIYRVGDWLQERYEIISTLGEGTFG
RVVQCMDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPENTNLCVRMFDWFDY
HGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQVCQAVKFLHDNKLTHTDLKPEN
ILFVSSDYELSYNLEKKRDERSVKSTAIRVVDFGSATFDHEHHSTIVSTRHYRAPEVILE
LGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMVRKTRKQKYFY
HGRLDWDENTSAGRYVRENCKPLRDPAALQPRPAAVLDGYNPFESDAPPPPFQTPSVAPP
PPVPAAAQPPRKASPTEPRNYGSYGSQASAAAAATAELLKRQEELNRKAEDLDRRERELQ
NAALGGSQTRLNNWPPLPSFCPVKPCFYQDIPVEIPADFQKTVTTMYYLWMASTIALFLN
FLASLAWFCVDPTSGSGFGLSILWALLYTPCSFVCWYRPMYKAFRSDSSFNFFVFFFVFF
AQNVMYVLQAIGIPNWGFSGWILSLIALRTNTAVAVMMILVSLSFTAVAVLGIIMLKKIH
SLYRRTGASFQKAQEEFAAGVFSNQAVRTAAANAAAGAATNAFRAP
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgccgcactcccggaggtaccgctcgtcggagcgcagcagccgcggcagttaccacgag
cgctaccggagccgcaagcacaagcggcggcggacgcgctcccgctccagcagcagcgag
cgggaccggcggcaccggcgcgaggacagctaccacgtccgatcccggagctacgacgac
cactccgcagaccgacgggcctacgaccgccgttactgtgacagctaccggcgcaacgac
tacagccgcgagcggggcgacgcctactacgagcccgagtaccgccactcctacgagtac
cggcgctcccgggaccgcgagggcagctaccggagctgcaaaagcagccggcgtaagcac
aggcggaggcggcgccgcagccggtcctttagccgctcctcatcgcagcggagtcgacag
agcagcagaagggccaagagtgtggaggacgacgacgaggggcatctgatctatcgcgtc
ggcgactggctacaagaaagatatgagattatcagcacgctgggggaaggcaccttcggc
agagtggtgcagtgcatggatcaccggaggggtggtgcacgtgttgctctgaaaatcatc
aaaaatgtagagaaatacaaagaggctgctcggctggaaatcaacgtgctggagaaaatc
aacgagaaggatcctgagaacacaaatctctgtgtcaggatgtttgactggtttgactac
cacggccacatgtgcatctccttcgagctgctggggctcagcacctttgatttcctgaag
gataacaactacctgccttaccccatccaccaagtacggcacatggccttccaggtgtgc
caggctgtgaagtttctgcatgacaataaactcacccacactgacctcaagccagagaac
atcctcttcgtgagctctgactacgagctctcctacaacctggagaagaaacgggatgag
aggagcgtgaagagcacggccatcagggtggtggattttggcagtgccacctttgaccac
gagcatcacagcaccatcgtctccaccaggcactaccgggcccctgaagtcatcctggag
cttggctggagccagccctgtgatgtgtggagtattggctgcatcatctttgagtattat
gtgggtttcacccttttccagacacatgacaaccgggagcacctggccatgatggagagg
attttggggccaattccttctcggatggtcaggaagacaaggaaacagaaatatttctac
cacggccgcctggactgggacgagaacacctcagctggacgctacgttcgggagaactgc
aaaccactgcgggaccccgcggcgttgcagccccggcccgccgccgtgctggatggctac
aaccccttcgagagcgacgcgccaccgccgccgttccagaccccctcggtagcgccgccg
cccccggtaccggcggccgcgcagcccccgcggaaggcgagtcccaccgagccccgtaac
tacggctcgtacggttcgcaggcctcggccgccgccgccgccacggcggagctgctgaag
cggcaggaggagctgaaccggaaagcggaggatctggaccggcgggagcgggagctgcag
aacgcggccctcggcggttcccagacgaggctcaacaactggccgccgctgccgtccttc
tgcccggtgaagccctgcttctaccaggacatccccgtggagatccccgctgacttccag
aagacagtgacaaccatgtactacctctggatggccagcaccatcgctctcttcctgaac
ttcctggcctcgctcgcctggttctgcgtggaccccacgtctgggtctgggtttggcctc
tccatcctctgggctctgctctacacgccctgttccttcgtctgctggtatcggcccatg
tacaaagctttcaggagcgacagttccttcaacttctttgtcttcttcttcgtcttcttc
gcccagaacgtgatgtatgtgctgcaggccatcggcatcccaaactggggattcagtggc
tggatcctgagcctgatagcactgcggactaacacggccgtggccgtgatgatgatcctg
gtgtccttgtccttcacggcggtggctgtgctggggatcattatgctgaaaaagatccac
tctctgtaccgccgcacgggtgccagcttccagaaggcccaggaggagtttgcagccggg
gtcttctccaaccaggccgtgcgcacggccgcggccaacgccgccgcgggcgcggccacc
aacgccttccgtgccccgtag

DBGET integrated database retrieval system