KEGG   Taeniopygia guttata (zebra finch): 100220023Help
Entry
100220023         CDS       T01082                                 

Gene name
CHRM4
Definition
cholinergic receptor, muscarinic 4
Orthology
K04132  
muscarinic acetylcholine receptor M4
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Neuroactive ligand-receptor interaction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100220023 (CHRM4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100220023 (CHRM4)
G protein-coupled receptors [BR:tgu04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    100220023 (CHRM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 488 aa AA seqDB search
MHNLSAQPWQAKMANLTYDNFTLGNHSEVAVQPPTNYKTVELVFIATVTGSLSLVTVVGN
ILVMLSIKVNRQLQTVNNYFLFSLACADLIIGVFSMNLYTVYIIKGYWPLGAVVCDLWLA
LDYVVSNASVMNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWILSFILWAPAILF
WQFIVGKRTVPERECYIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVRRHK
PESRKERKAKSLRFLKGPVVKQNNNNSPKRAVEVKEEVRNGKVDDQPSAQTEATGHQEEK
ETSNESSTVSMTQTTKDKPTAEVLPAGQGQSPAKPRVNPTSKWSKIKIVTKQTGTECVTA
IEIVPAKSGASNSLANSRPVNVARKFASIARSQVRKKRQMAAREKKVTRTIFAILLAFIL
TWTPYNVMVLINTFCETCVPETVWSIGYWLCYVNSTINPACYALCNATFKKTFKHLLMCQ
YRNIGTAR
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacctctctgctcagccctggcaggcaaagatggccaacctgacctatgacaac
ttcaccctgggcaaccactctgaggtggctgtgcagcctcccaccaactacaagacagtg
gagctggttttcattgctactgtcaccggctcgctcagtcttgtcaccgtggtggggaac
atcctggtgatgctctccatcaaggtgaaccgccagctccagactgtcaacaactatttc
ctcttcagcctggcctgcgcagacctcatcatcggggtcttctccatgaacctctacacg
gtctatatcatcaaaggctattggccactgggggccgtggtgtgcgacctgtggctggct
ctggactatgtggtgagcaatgcctctgtcatgaacctgctcatcatcagctttgaccgg
tacttctgtgtcaccaagcccctgacatacccggccaggaggaccaccaagatggcaggg
ctaatgattgcggccgcatggatattgtccttcattctctgggcccctgccatcttgttc
tggcagttcattgtgggcaagaggacagtccctgagagggaatgctacatccagttcctc
tccaaccccgcggtgacatttggcacagccattgctgctttttacctgcccgtggtcatc
atgacagtgctgtacatccacatctccctggccagcagaagcagggtaaggaggcacaag
cctgagagcaggaaagagaggaaagccaagtccctcagattcctcaagggccccgtggtc
aaacagaacaacaataattctcccaagagggccgtggaggtgaaggaggaggtgaggaat
gggaaagtggatgaccagccatctgcacagacagaggccactggccatcaggaggagaag
gagacatccaatgagtccagcaccgtcagcatgacccagaccacaaaagacaaacccaca
gcagaagtcttgccagcagggcaaggacagagtccagccaagcctcgggtgaacccaact
tccaagtggtccaagattaagattgtcaccaagcagactgggaccgaatgtgtcaccgcc
attgagattgtcccagccaagtcaggtgcctctaactccctggccaacagccgcccagtc
aatgttgccaggaagtttgccagcattgccaggagccaagtacggaagaagcgtcagatg
gctgcccgagagaagaaagtcacccgaaccatatttgccatcttgctggccttcatactc
acatggacaccctacaacgtgatggtcctcatcaacaccttctgtgagacctgcgtgccc
gaaacagtgtggtccatcggctactggctctgctatgtcaacagcaccatcaacccagcc
tgctacgccctctgcaatgccactttcaagaaaaccttcaagcaccttctcatgtgccag
tacaggaacattggcacagccagataa

DBGET integrated database retrieval system