KEGG   Taeniopygia guttata (zebra finch): 100220070Help
Entry
100220070         CDS       T01082                                 

Gene name
PLCG1
Definition
phospholipase C, gamma 1
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100220070 (PLCG1)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100220070 (PLCG1)
   04370 VEGF signaling pathway
    100220070 (PLCG1)
   04020 Calcium signaling pathway
    100220070 (PLCG1)
   04070 Phosphatidylinositol signaling system
    100220070 (PLCG1)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100220070 (PLCG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 1284 aa AA seqDB search
MAAGPGPGPGAPSEAEAAQLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQVTWSRG
SEKVEGAVDIREIKEIRPGRNSRDFDRYQEDPCFRPDHSHCFVVLYGTEFRLKTLSLQAT
SEDEVNMWIKGLNWLVADTLRAPTPLQIKRWLRKQFYSLDRNREDRXGGRNCSPVQGRVX
FFFKNPERRFHRALLSDVEQRNGDITYGQFAQLYRSLMFSAQKTMDVPFLERGTERSEHF
RVSLLELQKFLLEYQRELWAADTLQVQEFMFNFLRDPLREIDEPYFSLDEFLTFLFSKEN
SIWNSQLDMVCLENMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELD
CWDGPDGMPVIYHGHTLTTKIKFSDVLVTIKEHAFVTSDFPVILSIEDHCSIAQQRNMAQ
NFKKVFGDMLLTKPVDISADGLPSPNQLKRKILIKHKKLAEGSAYEELPTSVMYSENDIS
NSIKNGILYLEDPINHEWNPHYFVLTSSKIYYSGETTSDQGNEDEEEQKEVSNSTELHST
GEVFPREAGSGPATGRHIAERLLTXXCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQ
HCRIHSRQDAGSPKFFLTDNLVFDSLYDLITHYQEVPLRCNEFEMRLTEPVPQTNAHESK
EWYHANLTRAQAEHMLMRVPRDGAFLVRKRSEPSSYAISFRAEGKIKHCRVQQEGQTVLL
GNSEFESLVDLISYYEKHPLYRKMKLRYPINEETLEKIGTAEPDYGALYEGRHPGFYVEA
NPMPTFKCAVKALFDYKAQREDELTFTKNAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYV
EEITSPSSLEPEREQLDENSPLGDLLGGVLDVPSCQIAIRPEGKNNRLFVFSISMSSVSR
LSLDVAADTHEDLLDWVKKIREAAQTADARLSEGKMMERRKKIALELSELVVYCRPVPFD
EEKIGTERACYRDMSSFPETKAEKYVNKIKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPL
PMWICGSQLVALNFQTPDKPMQMNQALFMSSGQCGYVLQPTNMRDDIFDPFDKSTLRGTE
PLSISIEVLGARHLPKNGRGIVCPFVEVEVSGAEYDNAKQKTEIVADNGLNPLWTPKQFH
FQVSNPEFAFLRFVVYEEDMFSDENFLAQATFLVKGLKTGFRAVPLKNNYSENLELASLL
VKIDIFPCKENGEINLFNASSLRERAGDGSSQLLASRGREGSFELRYQQPFEDFRVSPEQ
LADHFESRERRVLRRTRVNGDNRL
NT seq 3855 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgggccgggcccgggccccggggcgcccagcgaggcggaggcggcgcagctc
tgccgcagcttggaggtgggcaccgtcatgaccctcttctactccaaaaagtcgcagcga
cccgagcggaaaactttccaggtgaagctggagacgcggcaggtcacctggagccgcggc
tccgagaaggtggagggggccgtggatattcgtgagatcaaagagatccgtccaggcagg
aactcccgtgattttgaccgctaccaggaggatccgtgtttccgacctgaccactcgcac
tgcttcgttgtcctctacggcaccgaattccggctgaagaccctcagcttgcaggccact
tctgaggatgaggtcaatatgtggatcaaggggctgaactggttggtggcagacacgctg
agggcacccacccccctgcagattaaaaggtggctccggaagcagttctactccctggat
cgcaaccgggaggacaggtaaggagggagaaactgcagtcctgttcaggggagggtttga
tttttttttaagaatcccgagcggaggttccaccgcgctctgctctctgatgtggagcag
aggaacggggacatcacgtacgggcagtttgcacagctctaccgcagcctgatgttcagc
gcccagaaaaccatggatgtcccgttcttggaaaggggtacagaaaggtctgagcacttc
agggtgtcactgctggagctgcagaagtttttgctggagtaccagagggagctctgggct
gcagatacccttcaggtacaggaattcatgttcaacttcctgagagaccctttgagggag
attgacgagccttacttctccctggacgaatttctcaccttcctgttttccaaagagaac
agcatctggaactcacaactggacatggtgtgtctggagaacatgaacaaccctctctcc
cattactggatctcctcctcacacaacacgtacctgacgggggatcagttctcgagcgag
tcctcgctggaggcctacgcccgctgcctgcgcatgggctgccgctgcatcgagctggat
tgctgggacggtcctgatggcatgccggtcatctaccacggacacaccttaaccaccaag
atcaagttctctgatgtcttggtcactattaaggagcacgcctttgtcacctctgatttc
cctgtcattctgtccattgaggaccactgcagcattgctcagcagaggaacatggctcag
aattttaagaaggtttttggagacatgctcttgaccaaaccagtcgatatttctgctgat
ggccttccatctccaaaccagctcaagaggaagattctcatcaagcacaagaagctggca
gagggcagtgcttacgaggagctgcccacgtcggtgatgtactcagagaatgacatcagc
aactccatcaagaatgggatcctctacctggaagaccccatcaatcatgagtggaaccca
cattactttgtgctgaccagcagcaagatctattattctggggagacaaccagtgaccaa
ggaaacgaggatgaggaagagcaaaaggaggtgagcaacagcacggagcttcactccaca
ggagaagtgtttccacgggaagctgggagcgggcctgcaacggggcggcacatcgcggag
cggctgctgacnnnnnnntgcatcgagacaggggcccccgacggctccttcctcgtcaga
gagagcgagaccttcgtaggagactacaccctctccttctggcgcaacgggaaggtgcag
cactgccggatccactcgcggcaggatgccggcagccccaagttcttcctgacggacaac
ctggtgttcgacagcctctacgacctcatcacccactaccaggaggtgccactgaggtgc
aacgagtttgagatgaggctgacggagccagtgccacagaccaatgcccacgagagcaaa
gagtggtaccacgccaacctcacgcgggcccaggccgagcacatgctgatgcgggtgccc
cgcgacggagccttcctggtgcgcaagaggagcgagcccagctcctatgccatctccttc
agggcagaagggaagatcaagcactgccgggtgcagcaggagggccagaccgtgctgctg
ggcaactctgaattcgagagcctggtggacttgatcagctactacgagaagcacccgctg
taccgcaagatgaagctgcgctaccccatcaacgaggagaccctggagaagattgggaca
gcggagccggactatggagccctgtacgagggacgccaccctgggttctatgtggaagcc
aaccccatgcccaccttcaagtgtgcagtcaaagccctgtttgactacaaggcacagagg
gaagacgagctcaccttcaccaaaaatgccatcatccagaatgtggagaaacaggaagga
ggctggtggagaggagattatggtggcaaaaagcagctgtggttcccttccaactatgta
gaggaaattaccagtcccagtagcctggagccagagcgggagcagctggatgagaacagc
cccctgggagacctgctcggaggggtcctggacgtgccctcctgccagatcgccatccgc
cccgaggggaagaacaatcgcctcttcgtcttctccatcagcatgtcctcggtgtcacgc
ctgtccctggacgtggcggccgacacgcacgaggacctgctggactgggtgaagaagatc
cgggaggcagctcagacagctgatgccaggctctctgaagggaagatgatggagaggaga
aagaagattgccctggagctttcagaactggtggtctattgccgacctgtgccctttgat
gaagagaagatcggcacagagagggcctgttaccgggacatgtcctcctttcccgagacc
aaggcagaaaagtacgtcaacaagatcaagggcaagaagttcctgcagtacaaccgcctg
cagctctcccgcatctaccccaagggccagcgcctcgactcctccaactacgaccccctg
cccatgtggatctgtggcagccagctggtggcactcaacttccagaccccggacaaaccc
atgcagatgaaccaggccttgttcatgtccagtggccagtgtgggtacgtcctgcagcca
accaacatgagggatgacatctttgacccctttgacaagagcacgttgcggggcacagaa
ccactctccatctccattgaggtcctgggggcccggcaccttcccaaaaatggaagggga
attgtttgtcctttcgtggaggtggaggtgtctggtgctgagtatgacaatgccaagcag
aaaacagagatcgtggctgacaacggcctgaaccctctctggaccccgaagcagttccac
tttcaggtcagcaaccccgagtttgccttcctccgcttcgtggtgtatgaggaggacatg
ttcagcgacgagaacttcctggctcaggccaccttcctggtgaaaggcctgaagacaggt
ttccgagctgttcccctcaagaacaactacagtgagaacctggagctggcttctctgctt
gtcaagatagacattttcccttgcaaggaaaatggcgaaataaacctcttcaatgcttca
tccctacgggaacgagcaggggatggctccagccagctgctggcaagcagaggcagagag
gggtcctttgagctgcggtaccagcagcctttcgaggatttccgtgtgtcccccgagcag
ctcgctgaccactttgagagccgggagcgaagggtactgcggaggacccgggtcaacggg
gacaaccggctgtag

DBGET integrated database retrieval system