KEGG   Taeniopygia guttata (zebra finch): 100220070Help
Entry
100220070         CDS       T01082                                 

Gene name
PLCG1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100220070 (PLCG1)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100220070 (PLCG1)
   04370 VEGF signaling pathway
    100220070 (PLCG1)
   04020 Calcium signaling pathway
    100220070 (PLCG1)
   04070 Phosphatidylinositol signaling system
    100220070 (PLCG1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100220070 (PLCG1)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100220070 (PLCG1)
Membrane trafficking [BR:tgu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100220070 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100220070 (PLCG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 1255 aa AA seqDB search
MTLFYSKKSQRPERKTFQVKLETRQVTWSRGSEKVEGAVDIREIKEIRPGRNSRDFDRYQ
EDPCFRPDHSHCFVVLYGTEFRLKTLSLQATSEDEVNMWIKGLNWLVADTLRAPTPLQIK
RWLRKQFYSLDRNREDRXGGRNCSPVQGRVXFFFKNPERRFHRALLSDVEQRNGDITYGQ
FAQLYRSLMFSAQKTMDVPFLERGTERSEHFRVSLLELQKFLLEYQRELWAADTLQVQEF
MFNFLRDPLREIDEPYFSLDEFLTFLFSKENSIWNSQLDMVCLENMNNPLSHYWISSSHN
TYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLVT
IKEHAFVTSDFPVILSIEDHCSIAQQRNMAQNFKKVFGDMLLTKPVDISADGLPSPNQLK
RKILIKHKKLAEGSAYEELPTSVMYSENDISNSIKNGILYLEDPINHEWNPHYFVLTSSK
IYYSGETTSDQGNEDEEEQKEVSNSTELHSTGEVFPREAGSGPATGRHIAERLLTXXCIE
TGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGSPKFFLTDNLVFDSLYDL
ITHYQEVPLRCNEFEMRLTEPVPQTNAHESKEWYHANLTRAQAEHMLMRVPRDGAFLVRK
RSEPSSYAISFRAEGKIKHCRVQQEGQTVLLGNSEFESLVDLISYYEKHPLYRKMKLRYP
INEETLEKIGTAEPDYGALYEGRHPGFYVEANPMPTFKCAVKALFDYKAQREDELTFTKN
AIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEITSPSSLEPEREQLDENSPLGDLLGGV
LDVPSCQIAIRPEGKNNRLFVFSISMSSVSRLSLDVAADTHEDLLDWVKKIREAAQTADA
RLSEGKMMERRKKIALELSELVVYCRPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKI
KGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFM
SSGQCGYVLQPTNMRDDIFDPFDKSTLRGTEPLSISIEVLGARHLPKNGRGIVCPFVEVE
VSGAEYDNAKQKTEIVADNGLNPLWTPKQFHFQVSNPEFAFLRFVVYEEDMFSDENFLAQ
ATFLVKGLKTGFRAVPLKNNYSENLELASLLVKIDIFPCKENGEINLFNASSLRERAGDG
SSQLLASRGREGSFELRYQQPFEDFRVSPEQLADHFESRERRVLRRTRVNGDNRL
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcttctactccaaaaagtcgcagcgacccgagcggaaaactttccaggtgaag
ctggagacgcggcaggtcacctggagccgcggctccgagaaggtggagggggccgtggat
attcgtgagatcaaagagatccgtccaggcaggaactcccgtgattttgaccgctaccag
gaggatccgtgtttccgacctgaccactcgcactgcttcgttgtcctctacggcaccgaa
ttccggctgaagaccctcagcttgcaggccacttctgaggatgaggtcaatatgtggatc
aaggggctgaactggttggtggcagacacgctgagggcacccacccccctgcagattaaa
aggtggctccggaagcagttctactccctggatcgcaaccgggaggacaggtaaggaggg
agaaactgcagtcctgttcaggggagggtttgatttttttttaagaatcccgagcggagg
ttccaccgcgctctgctctctgatgtggagcagaggaacggggacatcacgtacgggcag
tttgcacagctctaccgcagcctgatgttcagcgcccagaaaaccatggatgtcccgttc
ttggaaaggggtacagaaaggtctgagcacttcagggtgtcactgctggagctgcagaag
tttttgctggagtaccagagggagctctgggctgcagatacccttcaggtacaggaattc
atgttcaacttcctgagagaccctttgagggagattgacgagccttacttctccctggac
gaatttctcaccttcctgttttccaaagagaacagcatctggaactcacaactggacatg
gtgtgtctggagaacatgaacaaccctctctcccattactggatctcctcctcacacaac
acgtacctgacgggggatcagttctcgagcgagtcctcgctggaggcctacgcccgctgc
ctgcgcatgggctgccgctgcatcgagctggattgctgggacggtcctgatggcatgccg
gtcatctaccacggacacaccttaaccaccaagatcaagttctctgatgtcttggtcact
attaaggagcacgcctttgtcacctctgatttccctgtcattctgtccattgaggaccac
tgcagcattgctcagcagaggaacatggctcagaattttaagaaggtttttggagacatg
ctcttgaccaaaccagtcgatatttctgctgatggccttccatctccaaaccagctcaag
aggaagattctcatcaagcacaagaagctggcagagggcagtgcttacgaggagctgccc
acgtcggtgatgtactcagagaatgacatcagcaactccatcaagaatgggatcctctac
ctggaagaccccatcaatcatgagtggaacccacattactttgtgctgaccagcagcaag
atctattattctggggagacaaccagtgaccaaggaaacgaggatgaggaagagcaaaag
gaggtgagcaacagcacggagcttcactccacaggagaagtgtttccacgggaagctggg
agcgggcctgcaacggggcggcacatcgcggagcggctgctgacnnnnnnntgcatcgag
acaggggcccccgacggctccttcctcgtcagagagagcgagaccttcgtaggagactac
accctctccttctggcgcaacgggaaggtgcagcactgccggatccactcgcggcaggat
gccggcagccccaagttcttcctgacggacaacctggtgttcgacagcctctacgacctc
atcacccactaccaggaggtgccactgaggtgcaacgagtttgagatgaggctgacggag
ccagtgccacagaccaatgcccacgagagcaaagagtggtaccacgccaacctcacgcgg
gcccaggccgagcacatgctgatgcgggtgccccgcgacggagccttcctggtgcgcaag
aggagcgagcccagctcctatgccatctccttcagggcagaagggaagatcaagcactgc
cgggtgcagcaggagggccagaccgtgctgctgggcaactctgaattcgagagcctggtg
gacttgatcagctactacgagaagcacccgctgtaccgcaagatgaagctgcgctacccc
atcaacgaggagaccctggagaagattgggacagcggagccggactatggagccctgtac
gagggacgccaccctgggttctatgtggaagccaaccccatgcccaccttcaagtgtgca
gtcaaagccctgtttgactacaaggcacagagggaagacgagctcaccttcaccaaaaat
gccatcatccagaatgtggagaaacaggaaggaggctggtggagaggagattatggtggc
aaaaagcagctgtggttcccttccaactatgtagaggaaattaccagtcccagtagcctg
gagccagagcgggagcagctggatgagaacagccccctgggagacctgctcggaggggtc
ctggacgtgccctcctgccagatcgccatccgccccgaggggaagaacaatcgcctcttc
gtcttctccatcagcatgtcctcggtgtcacgcctgtccctggacgtggcggccgacacg
cacgaggacctgctggactgggtgaagaagatccgggaggcagctcagacagctgatgcc
aggctctctgaagggaagatgatggagaggagaaagaagattgccctggagctttcagaa
ctggtggtctattgccgacctgtgccctttgatgaagagaagatcggcacagagagggcc
tgttaccgggacatgtcctcctttcccgagaccaaggcagaaaagtacgtcaacaagatc
aagggcaagaagttcctgcagtacaaccgcctgcagctctcccgcatctaccccaagggc
cagcgcctcgactcctccaactacgaccccctgcccatgtggatctgtggcagccagctg
gtggcactcaacttccagaccccggacaaacccatgcagatgaaccaggccttgttcatg
tccagtggccagtgtgggtacgtcctgcagccaaccaacatgagggatgacatctttgac
ccctttgacaagagcacgttgcggggcacagaaccactctccatctccattgaggtcctg
ggggcccggcaccttcccaaaaatggaaggggaattgtttgtcctttcgtggaggtggag
gtgtctggtgctgagtatgacaatgccaagcagaaaacagagatcgtggctgacaacggc
ctgaaccctctctggaccccgaagcagttccactttcaggtcagcaaccccgagtttgcc
ttcctccgcttcgtggtgtatgaggaggacatgttcagcgacgagaacttcctggctcag
gccaccttcctggtgaaaggcctgaagacaggtttccgagctgttcccctcaagaacaac
tacagtgagaacctggagctggcttctctgcttgtcaagatagacattttcccttgcaag
gaaaatggcgaaataaacctcttcaatgcttcatccctacgggaacgagcaggggatggc
tccagccagctgctggcaagcagaggcagagaggggtcctttgagctgcggtaccagcag
cctttcgaggatttccgtgtgtcccccgagcagctcgctgaccactttgagagccgggag
cgaagggtactgcggaggacccgggtcaacggggacaaccggctgtag

DBGET integrated database retrieval system