KEGG   Taeniopygia guttata (zebra finch): 100220070Help
Entry
100220070         CDS       T01082                                 

Gene name
PLCG1
Definition
phospholipase C, gamma 1
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tgu00562]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:tgu04012]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:tgu04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:tgu04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:tgu04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 1284 aa AA seqDB search
MAAGPGPGPGAPSEAEAAQLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQVTWSRG
SEKVEGAVDIREIKEIRPGRNSRDFDRYQEDPCFRPDHSHCFVVLYGTEFRLKTLSLQAT
SEDEVNMWIKGLNWLVADTLRAPTPLQIKRWLRKQFYSLDRNREDRXGGRNCSPVQGRVX
FFFKNPERRFHRALLSDVEQRNGDITYGQFAQLYRSLMFSAQKTMDVPFLERGTERSEHF
RVSLLELQKFLLEYQRELWAADTLQVQEFMFNFLRDPLREIDEPYFSLDEFLTFLFSKEN
SIWNSQLDMVCLENMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELD
CWDGPDGMPVIYHGHTLTTKIKFSDVLVTIKEHAFVTSDFPVILSIEDHCSIAQQRNMAQ
NFKKVFGDMLLTKPVDISADGLPSPNQLKRKILIKHKKLAEGSAYEELPTSVMYSENDIS
NSIKNGILYLEDPINHEWNPHYFVLTSSKIYYSGETTSDQGNEDEEEQKEVSNSTELHST
GEVFPREAGSGPATGRHIAERLLTXXCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQ
HCRIHSRQDAGSPKFFLTDNLVFDSLYDLITHYQEVPLRCNEFEMRLTEPVPQTNAHESK
EWYHANLTRAQAEHMLMRVPRDGAFLVRKRSEPSSYAISFRAEGKIKHCRVQQEGQTVLL
GNSEFESLVDLISYYEKHPLYRKMKLRYPINEETLEKIGTAEPDYGALYEGRHPGFYVEA
NPMPTFKCAVKALFDYKAQREDELTFTKNAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYV
EEITSPSSLEPEREQLDENSPLGDLLGGVLDVPSCQIAIRPEGKNNRLFVFSISMSSVSR
LSLDVAADTHEDLLDWVKKIREAAQTADARLSEGKMMERRKKIALELSELVVYCRPVPFD
EEKIGTERACYRDMSSFPETKAEKYVNKIKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPL
PMWICGSQLVALNFQTPDKPMQMNQALFMSSGQCGYVLQPTNMRDDIFDPFDKSTLRGTE
PLSISIEVLGARHLPKNGRGIVCPFVEVEVSGAEYDNAKQKTEIVADNGLNPLWTPKQFH
FQVSNPEFAFLRFVVYEEDMFSDENFLAQATFLVKGLKTGFRAVPLKNNYSENLELASLL
VKIDIFPCKENGEINLFNASSLRERAGDGSSQLLASRGREGSFELRYQQPFEDFRVSPEQ
LADHFESRERRVLRRTRVNGDNRL
NT seq 3855 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgggccgggcccgggccccggggcgcccagcgaggcggaggcggcgcagctc
tgccgcagcttggaggtgggcaccgtcatgaccctcttctactccaaaaagtcgcagcga
cccgagcggaaaactttccaggtgaagctggagacgcggcaggtcacctggagccgcggc
tccgagaaggtggagggggccgtggatattcgtgagatcaaagagatccgtccaggcagg
aactcccgtgattttgaccgctaccaggaggatccgtgtttccgacctgaccactcgcac
tgcttcgttgtcctctacggcaccgaattccggctgaagaccctcagcttgcaggccact
tctgaggatgaggtcaatatgtggatcaaggggctgaactggttggtggcagacacgctg
agggcacccacccccctgcagattaaaaggtggctccggaagcagttctactccctggat
cgcaaccgggaggacaggtaaggagggagaaactgcagtcctgttcaggggagggtttga
tttttttttaagaatcccgagcggaggttccaccgcgctctgctctctgatgtggagcag
aggaacggggacatcacgtacgggcagtttgcacagctctaccgcagcctgatgttcagc
gcccagaaaaccatggatgtcccgttcttggaaaggggtacagaaaggtctgagcacttc
agggtgtcactgctggagctgcagaagtttttgctggagtaccagagggagctctgggct
gcagatacccttcaggtacaggaattcatgttcaacttcctgagagaccctttgagggag
attgacgagccttacttctccctggacgaatttctcaccttcctgttttccaaagagaac
agcatctggaactcacaactggacatggtgtgtctggagaacatgaacaaccctctctcc
cattactggatctcctcctcacacaacacgtacctgacgggggatcagttctcgagcgag
tcctcgctggaggcctacgcccgctgcctgcgcatgggctgccgctgcatcgagctggat
tgctgggacggtcctgatggcatgccggtcatctaccacggacacaccttaaccaccaag
atcaagttctctgatgtcttggtcactattaaggagcacgcctttgtcacctctgatttc
cctgtcattctgtccattgaggaccactgcagcattgctcagcagaggaacatggctcag
aattttaagaaggtttttggagacatgctcttgaccaaaccagtcgatatttctgctgat
ggccttccatctccaaaccagctcaagaggaagattctcatcaagcacaagaagctggca
gagggcagtgcttacgaggagctgcccacgtcggtgatgtactcagagaatgacatcagc
aactccatcaagaatgggatcctctacctggaagaccccatcaatcatgagtggaaccca
cattactttgtgctgaccagcagcaagatctattattctggggagacaaccagtgaccaa
ggaaacgaggatgaggaagagcaaaaggaggtgagcaacagcacggagcttcactccaca
ggagaagtgtttccacgggaagctgggagcgggcctgcaacggggcggcacatcgcggag
cggctgctgacnnnnnnntgcatcgagacaggggcccccgacggctccttcctcgtcaga
gagagcgagaccttcgtaggagactacaccctctccttctggcgcaacgggaaggtgcag
cactgccggatccactcgcggcaggatgccggcagccccaagttcttcctgacggacaac
ctggtgttcgacagcctctacgacctcatcacccactaccaggaggtgccactgaggtgc
aacgagtttgagatgaggctgacggagccagtgccacagaccaatgcccacgagagcaaa
gagtggtaccacgccaacctcacgcgggcccaggccgagcacatgctgatgcgggtgccc
cgcgacggagccttcctggtgcgcaagaggagcgagcccagctcctatgccatctccttc
agggcagaagggaagatcaagcactgccgggtgcagcaggagggccagaccgtgctgctg
ggcaactctgaattcgagagcctggtggacttgatcagctactacgagaagcacccgctg
taccgcaagatgaagctgcgctaccccatcaacgaggagaccctggagaagattgggaca
gcggagccggactatggagccctgtacgagggacgccaccctgggttctatgtggaagcc
aaccccatgcccaccttcaagtgtgcagtcaaagccctgtttgactacaaggcacagagg
gaagacgagctcaccttcaccaaaaatgccatcatccagaatgtggagaaacaggaagga
ggctggtggagaggagattatggtggcaaaaagcagctgtggttcccttccaactatgta
gaggaaattaccagtcccagtagcctggagccagagcgggagcagctggatgagaacagc
cccctgggagacctgctcggaggggtcctggacgtgccctcctgccagatcgccatccgc
cccgaggggaagaacaatcgcctcttcgtcttctccatcagcatgtcctcggtgtcacgc
ctgtccctggacgtggcggccgacacgcacgaggacctgctggactgggtgaagaagatc
cgggaggcagctcagacagctgatgccaggctctctgaagggaagatgatggagaggaga
aagaagattgccctggagctttcagaactggtggtctattgccgacctgtgccctttgat
gaagagaagatcggcacagagagggcctgttaccgggacatgtcctcctttcccgagacc
aaggcagaaaagtacgtcaacaagatcaagggcaagaagttcctgcagtacaaccgcctg
cagctctcccgcatctaccccaagggccagcgcctcgactcctccaactacgaccccctg
cccatgtggatctgtggcagccagctggtggcactcaacttccagaccccggacaaaccc
atgcagatgaaccaggccttgttcatgtccagtggccagtgtgggtacgtcctgcagcca
accaacatgagggatgacatctttgacccctttgacaagagcacgttgcggggcacagaa
ccactctccatctccattgaggtcctgggggcccggcaccttcccaaaaatggaagggga
attgtttgtcctttcgtggaggtggaggtgtctggtgctgagtatgacaatgccaagcag
aaaacagagatcgtggctgacaacggcctgaaccctctctggaccccgaagcagttccac
tttcaggtcagcaaccccgagtttgccttcctccgcttcgtggtgtatgaggaggacatg
ttcagcgacgagaacttcctggctcaggccaccttcctggtgaaaggcctgaagacaggt
ttccgagctgttcccctcaagaacaactacagtgagaacctggagctggcttctctgctt
gtcaagatagacattttcccttgcaaggaaaatggcgaaataaacctcttcaatgcttca
tccctacgggaacgagcaggggatggctccagccagctgctggcaagcagaggcagagag
gggtcctttgagctgcggtaccagcagcctttcgaggatttccgtgtgtcccccgagcag
ctcgctgaccactttgagagccgggagcgaagggtactgcggaggacccgggtcaacggg
gacaaccggctgtag

DBGET integrated database retrieval system