KEGG   Taeniopygia guttata (zebra finch): 100220129Help
Entry
100220129         CDS       T01082                                 

Gene name
TMX3
Definition
thioredoxin-related transmembrane protein 3
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100220129 (TMX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 457 aa AA seqDB search
MAAAPGRRPRCLLWAAVVAHVVASGAGFVEDLDESFKENRKDDIWLVDFYAPWCGHCKKL
EPVWNEVGIEMRNMGSPVKVGKMDATSFSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTK
DDIIEFANRVAGPLIRPLPSQHMFEHVQKRHLVLFVYVGGESPLKEKYIEVASELIVYTY
FFSASEDVLPEYVTLPELPAVMVFKDGTYFVYDEYEDGDLSSWVNRERFQGYLHVDGFTL
YELGDTGKLVAIAVIDDKNSSVKHTRLKSIIQEVARDYRDHFHRDFQFGHMDGNDYINSL
LMDDLTIPTIVVLNTSNQQYFLPDRHIESTEDMVQFINNILDGTAEAQGGDGLLQRIKRI
IYDAKSTIVSVFKSSPLLGCFLFGLPLGVISIMCYGICTADTEGEVFEHEGAKKESGDRE
LTDEGSEEEQEEEKNGKYTELSDGELKQKDIMEKKKD
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagcgccgggccgccggccgcgctgcctcctctgggcggcagtggttgcacat
gtggtggcgtcaggtgcaggttttgtggaggatctagatgagtcgtttaaagaaaaccgt
aaagatgatatttggcttgtagatttttatgcaccttggtgtggccactgtaagaaacta
gagcctgtgtggaatgaagtgggtatagaaatgagaaacatgggttctccagtaaaagtt
gggaagatggatgcaacttccttttctagtattgcatctgaatttggagtgcgaggctat
ccaacaattaagctcttgaaaggtgacttggcatacaactacagaggacctagaaccaaa
gatgatataattgaatttgctaacagagtggcaggacctctcatcaggccacttcctagc
cagcatatgtttgagcatgtgcaaaagagacatcttgtactttttgtatatgttggtggt
gaatctcctttaaaggaaaaatacattgaggttgcttcagaactaatagtttatacatac
tttttttctgcctcagaagatgtgctgcctgagtatgtgacattgcctgaattgcctgct
gttatggtcttcaaagatggaacttactttgtttatgatgagtatgaagatggtgatttg
tcatcctgggtaaacagagaaagatttcaaggttaccttcacgtagatggctttacactt
tatgaacttggagatacaggaaaacttgtggctattgcagtcattgatgataaaaactct
tcagtgaaacataccagattaaagtctattattcaggaagttgccagagattatcgggat
cactttcacagggatttccagtttggccacatggatggaaatgattacattaatagttta
ctaatggatgacttgacaatccctactattgttgtattgaatacctccaatcagcagtat
tttctaccagataggcacattgagagcacagaagacatggttcaatttattaacaatatc
ctggatggtacagctgaagcacagggtggtgatgggcttctgcagcgaatcaagagaata
atctatgatgccaagtctactatagtgtctgtgttcaagagttcaccactgctgggatgc
tttctctttgggttacccctgggggtcatcagcatcatgtgttatggaatctgcacagct
gatacagagggagaggtatttgagcatgagggagctaaaaaagaaagtggtgatcgagaa
ctcacagatgaaggcagtgaggaagaacaagaggaggaaaagaatggaaaatacacagaa
ctttcagatggagagcttaaacagaaagacattatggaaaagaaaaaagactaa

DBGET integrated database retrieval system