KEGG   Taeniopygia guttata (zebra finch): 100220267Help
Entry
100220267         CDS       T01082                                 

Gene name
USP24
Definition
ubiquitin specific peptidase 24
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.4.19.12]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100220267 (USP24)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100220267 (USP24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 2502 aa AA seqDB search
MKYIQKNDENGNCSGEGIEFPTTNLYELESRVLTDHWSIPYKREESLGKCLIASTYLARL
GLSDSDENCKRFMDRCMPEAFKKLLTSSAVHKWGTEIHEGIYNMLMLLVDLVAERVKQDP
IPVGLLGVLTMAFNPDNEYHFKNRMKVCQRNWAEVFGEGNMHAVSPISTFQKEPHGWLVD
LVNRFAELGGFSAIQSKLNSEDIELGAISALVQPFGVCAEYLNSSVVQPMLDPVIHKMIK
YVQNVEEKDLKDKRLVSIPELLSGIKLLCMRFQPDLVTAVDDLRLDILLRMLKSPHFSAK
MNSLKEVTKLIEDSTVSKSVKNAIDTDRLLNWLVENSVLSIALEGNIDQAQYCDRIKGII
ELLGSKLSLDELTKIWRIQSGQSSTVIENIHTIIAAAAVKFSSDQLNHLFVLIQKSWETE
SDRVRQKLLSLIGRIGREARVETTTGKVLEVLWELAHLPTLPCSLIQQALEEHLTILSDA
YAVKEAIKRSYIIKCIEDIKRSSQHNNPQFVWVVPALRQLHEITRSFIKQTYQKQDKSII
QDLKKNFEIVKLVTGSLISCHRLAASVAGPGGLVGATLVDGRYTYREYLEAHLKFLAFFL
QEATLYLGWNRAREIWECLVTGQDVCELDREMCFEWFTKGQHDLESDVQQQLFKEKILKL
ESYEITMNGFSLFKTFFENVNLCDHRLKRQGTQLSVEKLELIGMDFIWKIAMESPDEEIA
NEAIQLIINYSYINLTPRLKKDSVSLHKKFIADCYTRLEAASSALGGPTLTHAVTRATKM
LTATAMPTVATSVQSPYRSTKLVIIERLLLLAERYVITIEDLYSVPRTILPHGASFHGHL
LTLNVTYESTKDTFTIEAHSNETVGSVRWKIAKMLNSPVENIQIFANDSLLTVNKDQKLL
HQLGFSDEQILTVKTSGSGTPSGSSADSSTSSSNSSSVFSSSYAMEQEKSLPGVVMALVC
NVFDMLYQLANLEEPRITLRVRKLLLLIPTDPAIQEALDQLDSLGRKKTLLSESSSQSSK
SPSLSSKHQHQPSASSILESLFRSFAPGMSTFRVLYNLEVLSSKLMPTADDEMARNCAKS
FCENFLRAGGLSLVVNVMQRDSIPSEVDYETRQGVYSICLQLARFLLVGQTMPTLLDEDF
IKDGVEALSSRPFRNVSRQASRQMSICGTPEKSSYRQLSVSDRSSIRVEEIIPAARVAIQ
TMEVNDFTSTVACFMRLSWAAAAGRLDLVGSSQPIKESNTLFPAGIRNRLSSSGSNCSSG
SEGEPTALHAGICVRQQSVSTKDALIAGEALSLLVTCLQLRSQQLGSFYNLPCVADFIID
ILLGSPSAEIRRVACDQLYTLSQTDTSAHPDVQKPNQFLLSVVLGAQLPLWSPTSIMRGI
NQRLLSQCTEYFDLRCQLLDDLTSSEMEQLKISPAAMLEDEITWLDNFEPNRTAECETSE
ADNILLAGHLRLIKTLLSLCGAEKEMVGSSLIKPLLDDFLFRASRIILNSHSPAGSAAIS
QQDFHPKCSTADSRLAAYEVLVMLADSSPSNLQLITKELLSMHHQCDPALTKEFDYLPPV
DSRSISGFVGLKNGGATCYMNAVFQQLYMQPGLPEALLSIDDDTDNPDDNVFYQVQSLFG
HLMESKLQYYVPENFWKIFKMWNKELYVREQQDAYEFFTSLIDQMDEYLKKIGRDQIFKN
TFQGIFSDQKICKDCPHRYEREEAFMALNLGVTSCQSLEISLDQFVRGEVLEGSNAYYCE
KCKEKRTTVKRTCIKVLPSLLVIHLMRFGFDWESGRSIKYDEQIRFPWMLNMEPYTVSGM
ARQDSSSEVGENGRNTDQGGGGGGSPRKKVAPTENYELVGVIVHSGQAHAGHYYSFIKDR
RGCGKGKWYKFNDTVVEEFDLTDETLEYECFGGEYRPKVYDQSNPYPDVRRRYWNAYMLF
YQRVSDQNSPVLPKKSRVSVVRQEAEDLSLSAPSSPEISPQSSPRPHRPNSDRLSILTKL
VRKGEKKGLFVEKMPVRIYQMVRDENLKFMKNRDVYSSDYFSFVLSLASLNATKVKHPYY
PCMAKVSLQLAVQFLFQTYLRTKKKLRADTEEWIATIDALLSKSIDACQWLVEYFVGPEG
RELVKTFLLECSVREVRVAVATILEKTLDSALLYQEKLKTLHQLLEVLLALLDKDVPENC
KNCAQYFLLFNNFVQKQGIRASSLLLRHSALRHMVNFLLGPNRQSNQNRRWSSAQAREFG
YLHNTVALLVLHSDVSSQRNVAPGLFKQRPPLSITTSGPLLVLHEEVEALLFLSEGKPYL
MEVMHALRELTGSLSVLMEMVVYCCFCNEHFSFTVLHFIKTQLETAPPHELKNIFQLLHE
ILVIEDPLQVERIKFAFETENGLIALMHHSNHVDSSRCYQCVKFLVTLAQKCPTAKDYFK
ENSHHWSWAVQWLQKKMSEHYWAPQSNVSNETSTAKTFQRTISAQDTLAYATALLNEKDQ
SGSSNGSESSPANENGERHLQQGSESPMMIGEPKSDLDDVDP
NT seq 7509 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatccagaaaaatgatgaaaatgggaattgctctggtgaagggattgagttt
ccaacaaccaacttgtatgagctggagagcagagttttgacagatcactggtccataccc
tacaagagggaggagtctctaggcaagtgcctaattgcatccacctacctggcaagactg
ggtctttctgattctgatgagaattgcaagaggtttatggacagatgcatgcccgaagca
tttaaaaagctgttgacatccagtgctgttcacaagtggggaaccgaaatccatgaagga
atctacaacatgctcatgctgctggtggacctggttgcagagagagtaaaacaagatccc
atccctgtgggcctgcttggtgtgcttacaatggcatttaatcccgacaatgaatatcat
ttcaagaatcgaatgaaggtgtgccagagaaactgggcagaagtctttggggaggggaac
atgcatgctgtctcacccatatccacttttcagaaggaacctcatgggtggctggtagat
ctggttaacaggtttgcagaattgggtggattttcagcaattcagtccaaactcaattct
gaagatattgaacttggggcaatctctgcattagttcagccatttggagtttgtgcagaa
tatcttaactcttctgtagtacagcccatgctggatccagtcattcataaaatgattaaa
tatgtacagaatgtagaagagaaggacttgaaagacaagagactggtgagtatccctgag
ctcttgtctgggatcaaactgctgtgtatgcgcttccagcctgacctggtcacggcagtc
gatgacttgcggctggacattctgctgcgcatgttgaaatccccccacttcagtgcaaaa
atgaattccctcaaagaagtaacaaaattaatagaagacagcactgtgtccaagtcagtg
aagaatgcaatagacacagaccgactgctgaattggctcgtggagaattcagtcctgtca
attgctctggaaggtaatatagaccaagcacagtactgtgatcgtataaagggaattatt
gaactgctgggcagcaaattatctttagatgagctcactaaaatttggagaattcagtca
ggacagtcctccactgtgattgagaacatacacaccattattgctgcagctgctgtgaag
tttagctctgatcagctcaatcatttatttgttctaatccaaaagagctgggagacagag
agtgaccgagtgaggcagaagctgctgagcctcattgggcgcattggccgagaagctcga
gtggaaacaaccactggcaaggttctggaagtactttgggagctggctcaccttccaacg
ttaccgtgcagtcttatccagcaggccttggaggaacacctgacaatcctcagtgatgct
tatgcagtgaaagaggcaatcaaaaggagctacatcatcaaatgcatagaggatattaag
aggtcgtcccagcacaataatcctcaatttgtgtgggtggtgccagccttgcgtcagctc
catgaaatcacacgttcatttattaagcaaacttaccaaaaacaagacaagagcattatt
caagatttaaagaaaaactttgaaatagtgaagttggtgacaggaagcttgatatcctgt
caccgtttggctgcatctgtggcaggcccaggagggctggtgggagcaacactggtggat
ggccgatacacttaccgggagtatttggaggcacatctaaaatttttggcattttttctg
caagaagccaccctttatttgggctggaatcgtgccagggagatctgggaatgccttgta
actggccaagatgtttgtgagttggaccgagagatgtgctttgagtggtttacaaaaggg
cagcatgatctggagagtgatgtgcagcaacagctcttcaaagagaaaattcttaaactg
gaatcatatgaaattactatgaatggttttagtttatttaagacattctttgaaaatgtg
aacctgtgtgaccatcggctgaagagacaaggaactcaactgagcgtagaaaaactggaa
ttaataggaatggatttcatttggaagattgcaatggagtcaccagatgaagaaattgcc
aatgaagctattcaattgataataaattacagctatattaatctaactcccagattgaaa
aaggattcagtatcactgcacaagaaattcattgctgattgctacacacgattagaggca
gccagctctgcgctcggcggtccaacattaacacacgctgtcacaagagctacaaaaatg
ctcacagcaactgccatgcctacagtggcaacatcggttcagtctccttacaggtcaact
aaacttgtaataattgagaggctgctgctgttggcagagcgttatgtgataacaatagag
gacctttactctgttccccgaactattctacctcatggtgcctctttccatggacatctt
ttaacccttaatgttacatatgagtctaccaaagataccttcaccatagaggctcatagc
aatgaaactgtaggaagtgtcaggtggaagatagcaaagatgttgaattcacctgtggaa
aatatacaaatatttgccaatgacagcctgctaacagtaaacaaagatcagaaactactc
caccagctgggtttctctgatgaacaaatccttacagtaaaaacatcaggaagtgggact
ccatcagggagctctgcagattcctcaaccagttccagcaacagcagcagtgtatttagt
tcatcctatgcaatggaacaggagaaatctctccctggagtcgtcatggctctcgtgtgt
aatgtgtttgatatgctttaccagcttgccaacctggaggagccaaggataacactgcga
gtgaggaagcttctgctcctgattcccactgacccagctattcaggaggctcttgaccag
cttgattccctgggaagaaagaaaacactgctttcagaatccagttctcagtcctcaaaa
tccccatccttgtcttcaaaacaccaacatcagcccagtgccagttcaattttagaaagt
cttttcagatcttttgctccaggcatgtccacattcagagtgctctacaatttggaggtg
ctgagctccaagctgatgccaactgcagatgatgaaatggcaaggaactgtgccaagtct
ttctgtgaaaatttcctcagagcaggaggtttgagtttggtggtgaatgtgatgcagaga
gattccatcccatcagaggtggactatgaaacaagacaaggagtctattccatctgcctg
cagcttgcaaggttcttgctggttgggcagacaatgcccactctgctggatgaggatttc
atcaaggatggggtggaagctctgtcctcgcggcccttccgcaacgtgagccggcaggcg
agcaggcagatgtccatctgtgggactcctgagaagtcctcctaccgccagctctccgtg
tctgacagatcctccatcagagtagaagaaatcatcccagctgcaagagttgccatacaa
accatggaggtgaacgatttcacctccacagtggcttgtttcatgcgcctctcgtgggct
gctgctgcaggacgcctggacctcgtgggaagtagtcagcccatcaaagagagcaacact
ctcttccctgctgggattagaaacagacttagcagctcaggaagtaactgcagttcagga
agcgaaggggagcccacggcgctgcacgctgggatctgtgtgaggcagcagtctgtgtcc
accaaagatgctctcattgctggggaagccttgtctctcttagtaacctgccttcagcta
cgtagtcagcagctaggatctttttacaacttgccttgtgttgctgatttcatcattgat
attctgcttggatcaccaagtgctgagatccgtcgcgttgcctgtgaccagctgtacacc
cttagccagacagacacatcagctcacccagatgtacaaaagccaaaccagttcctcctg
agcgttgttcttggggcccagctgcctctttggtcaccaaccagcatcatgagaggaatc
aaccagagacttttgtcccagtgtacagaatattttgacctgagatgtcaattactggat
gacctgacatcatcagaaatggagcagctgaagataagcccagctgccatgttagaagat
gagatcacttggctggacaattttgagcccaaccgcacggccgagtgtgagactagtgag
gctgataacatcctgttagcaggacacttgaggctcatcaagactctcctttcactctgt
ggggcagagaaggaaatggttggttcatctttgattaagccattgttggatgatttcctg
ttccgagcatccaggattattctgaacagccattccccagcaggcagtgctgcaatcagt
cagcaagacttccatccaaaatgcagcacggcagacagcagattagctgcttatgaagtg
ctggtgatgctggctgatagctcaccctccaatctccagcttatcacaaaggagttgctt
tccatgcaccaccagtgtgaccctgcactcaccaaggagtttgattaccttccaccagtg
gacagccgctccatttctggatttgtgggactcaagaatggtggagctacttgttacatg
aatgctgttttccagcagctgtatatgcagcctggtctcccagaggccttgctttccatt
gatgatgatactgacaatcctgatgacaatgtgttctatcaagttcaatctctttttggt
catttgatggaaagcaagctacagtattatgtacctgagaacttttggaagattttcaag
atgtggaataaggaactttatgttagagagcaacaagatgcttatgagttcttcaccagc
cttatagatcaaatggatgagtacctcaagaaaataggaagagaccaaatatttaagaat
acttttcaaggaattttctctgatcagaagatctgcaaggactgtcctcacaggtatgag
cgtgaggaagccttcatggctctcaaccttggtgtgacttcatgtcaaagcctggaaata
tcactggatcagtttgttagaggagaggttctggaaggaagcaatgcatactactgtgaa
aagtgcaaagaaaagagaactacagtgaagcgcacctgcattaaagtcttacccagcctg
ctggtgattcacctgatgagatttggctttgactgggagagtggccgttctattaaatat
gatgaacaaataaggtttccctggatgctgaacatggagccttacactgtgtcagggatg
gctcgtcaggactcgtcctcagaagtgggggaaaacggcaggaacacagaccagggagga
ggaggaggaggctccccaaggaagaaagttgcccctacagaaaactacgagctcgttggt
gtgattgtccacagtggccaggctcatgcagggcactactactccttcatcaaggacagg
agaggctgtggaaaaggaaagtggtataaatttaatgacaccgttgttgaagaatttgat
ttgactgatgaaaccctggaatatgaatgttttggtggagagtatagacctaaagtctac
gatcaatcaaatccctaccccgacgtgcgccggcgctactggaacgcctacatgctgttc
taccagagagtgtccgaccagaactcccctgtcctgccaaagaaaagcagagtcagcgtc
gtgcgtcaggaggctgaggacctctccttatctgctccctcttcaccagaaatttcaccc
cagtcatcacctcgaccccacaggcccaacagtgaccgtctctccatcctgaccaagctg
gttcgaaaaggagaaaaaaagggactctttgtagagaaaatgcctgtgaggatatatcag
atggtgagagatgaaaacttgaaatttatgaagaacagagatgtatacagtagtgactac
tttagttttgttctgtcattagcttccctgaatgctactaaggtaaagcatccctattat
ccctgcatggcaaaggtgagcttacagctggcagtccaattcctcttccaaacctatctc
cgaaccaagaagaaactcagggctgatacagaagaatggattgccaccatagatgcactg
ctctccaaaagcattgatgcttgtcagtggctggtggaatatttcgttgggccagagggc
cgggagctggtaaaaactttcctgctggaatgcagtgtgagggaggtgcgagttgctgtg
gccactatccttgaaaaaaccctcgacagtgccttgctttatcaggagaagttaaaaact
ctacatcagttactggaggtgctacttgctctattggataaagatgtacctgaaaactgt
aaaaactgtgctcagtactttttgctattcaataactttgtacagaagcagggaataagg
gctagcagtcttctcctcagacactctgccctgaggcacatggtcaactttctccttggc
ccaaacaggcagagcaatcagaaccgcaggtggagttcagcacaggcacgtgagtttgga
tatcttcacaacactgtagcactacttgtcttgcactctgatgtctcctcacaaagaaat
gttgctcctggtctctttaagcagcgtccacctctcagcatcaccacttcagggccactt
ctggtgctccatgaagaagtggaagccttgctgttcctgtctgagggaaagccctactta
atggaggtgatgcacgcgctgcgggagctcacggggtcgctgtcggtgctcatggagatg
gtggtgtactgctgcttctgcaatgagcacttctccttcactgtgctgcacttcatcaag
actcaactggaaactgctccacctcatgaactaaaaaacatattccagttactccatgag
atcctggttattgaagacccattgcaagtagagcgcatcaaatttgcctttgaaactgaa
aatggattaatagccttgatgcaccacagcaaccacgtggacagcagccgttgctaccag
tgtgtcaagttcctggttactctggctcagaagtgccctactgcaaaagattacttcaag
gagaattcacaccactggagttgggctgtgcagtggctacagaaaaagatgtctgaacat
tactgggctcctcagagtaacgtgtccaatgaaacatccactgcaaaaaccttccagcgc
actatttcagcacaggacactctggcctatgccacagccctgctgaatgagaaggatcag
tctggaagcagcaatgggtcagaaagcagccctgccaatgagaatggagagaggcacctg
cagcagggctcagagtctcctatgatgattggggagcctaaaagtgaccttgatgacgtt
gacccttag

DBGET integrated database retrieval system