KEGG   Taeniopygia guttata (zebra finch): 100220325Help
Entry
100220325         CDS       T01082                                 

Gene name
USP42
Definition
ubiquitin specific peptidase 42
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 1282 aa AA seqDB search
MTIVNKPKSSKSKKSSSRRSDKSMKPRTKKMTSRTASLGRVPPTEDPNKVSVDKGPGGHI
YCRSSQKSKPFAQRDLVVNDGIAPPQRILFPPEKICMDWQQTQSVGVGLQNLGNTCFLNS
TLQCLTYTPPLANYMLSLEHTKSCHVEGFCMMCTMESHINQVLCCSNNAIKPTSVINGLK
RIGKHFHFGSQEDAHEFLCFTVDALQKACLNGSTKLDRSSQATTLIYQIFGGYLRSRVKC
LNCKAVSDTYEPFLDVTLDIKAVTSVTRALEQFVKPEQLDGENSYKCSKCKKMVPASKRY
TIHRSSNVLTISLKRFANFTGGKINKDVKYPEYLDLRAYMSQSIGEPLIYALYAVLVHSG
FNCNAGHYLCFIKAGNGLWYRMNDASVELSDIKTVLNQQAYVLFYIRRYDLTLGERAFYL
PTPSYPRSFLGQRGANSKQAAFMGPRLPPHMIKSSSRLNGNGPLKEDPSAVGVAVKRPSS
APPTACVQNWAISRPSMTDPSKTQKITISIHNKLPTRQAVPQAECPSSAREEEDLKPLPS
ATITNSSAAEPTSNLSTVSVATNVSKQEVPDEIFVEPAVNGNPKLCSDNMVPFGAEPSGK
SEESKGLFKRHCNIISSNGILIGKVVRTLHNSHSSCQNAEERSQHELPKIDSLNGAISLD
NEYKENGLKLDDSTCQVQPVKPSEIFFAKANGVLEAMPKPLSPDPQGILESLTYSQLNSL
SEEKSVSGPQKSSDNDGVTDTVVMEALFAYEESRKVPSKFSCEVEKLFTQSDSETIFTKE
EVAESIITKADNAHLNINGQHKVRKKSLDTEGEFLGQCESEDIRDKDKLRRSKEPEFISK
ENPLYIKGSPESKEKLGQISSIKPDIECSSKKLASLDITDKCQDTKDISNNYVEVPPVND
SSITKLDKVLESQFSRADEGPSNQTCEDDGKHMKKNKKKIHDSKRTDKEHYRRKRENSDT
EEKERQTRNKSDDHSHRRRSSHSVETNKQSRHKQEYCSESKYRSSHSERNTLSNGRSSGK
YSRYRSRSRERTDPDRNRYYYSKGDRPWIRERYYQDEPRRWEKCRYYNDYYSSHGTRDGR
ERRSSHCDKDYDKSSQAYSRSHKDYHCKSRWAHSTLSREEDVHHFSSHRANFHHCSVPQQ
HSEKYSHERHTLPPVSAHSNFEDSSRENEKEKLRNGKRKYSHQEESGSDIEKKCRKTDDQ
RIKKYKKVKKKKKSKDKHREKDYKLYDLDCSVLHFDNDNRKHKKKKKKKKHDRKLKDLLE
YLDPRFQKKTWEKKEESRPPDD
NT seq 3846 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagttaacaagccaaaatcttcaaagtctaaaaaatcttcttcaagacggtct
gacaaatctatgaaaccccgtactaaaaaaatgacgtctcgcactgcaagtttgggccgg
gtacctcctacagaagatccaaacaaagtctctgtggacaaaggtcctggggggcatatt
tattgtagatcatctcaaaaatcaaagccttttgcccaaagagatctagttgttaatgat
gggattgctccgccacaaagaattctttttccacctgagaaaatctgtatggattggcaa
caaacacaaagtgttggagttgggctgcagaacctcggcaacacatgtttccttaattct
actctccagtgtttgacctacacgcctcctcttgccaattacatgctttcacttgagcac
accaagtcatgtcatgtagaaggattctgtatgatgtgcacaatggaaagtcacatcaac
caggtcctgtgttgctctaataatgccatcaaacctacgtctgttatcaatggccttaaa
agaataggaaaacatttccactttggcagtcaagaggatgcacatgaattcttatgcttc
actgttgatgctttacagaaagcttgcttgaatggaagcaccaaattagacagatcttct
caagccaccacacttatttatcaaatatttggaggatatctaagatctcgagtaaagtgc
ttgaactgcaaagcagtgtcagatacatacgagccatttctcgacgttactttggatata
aaggcagttacatctgtcaccagagctctagaacaatttgtgaaaccggaacagctggat
ggtgaaaatagctacaagtgtagcaagtgcaaaaagatggttccagcatcaaagagatac
acaatacatcgctcttcgaatgttctcacaatatcgctgaaaagatttgcaaattttaca
ggtggaaagatcaacaaggatgtaaaataccctgaatatttggatcttcgagcatatatg
tcccaatccattggagaacccctcatctatgctttatatgcagttcttgtacatagtggc
ttcaactgtaatgctggacactatctctgcttcataaaggctggtaatggactttggtac
cgaatgaatgatgcctcagtagagctttctgatatcaaaacagttctcaatcagcaagct
tacgtacttttttatatcaggcgctacgacctgacgctgggggaacgagccttttacctg
cccacaccctcctacccccgctccttcctgggccagcgcggggccaacagcaagcaggct
gccttcatgggacctcggcttcctccccacatgattaagagttccagtcgtttaaatgga
aatggacccttaaaagaggatcccagtgctgttggtgttgctgtaaaaaggccatcttca
gctccaccaacagcttgtgttcaaaactgggcaatttccaggccttcaatgacagaccct
tccaaaacgcagaagatcacgatcagcattcacaacaagctgcccacacggcaggcggtg
ccgcaggcggagtgtccaagcagcgctagggaggaggaggatctgaagccccttccttca
gccacaattacaaactcttccgcagcagagcctacctcaaacctctccacagtgtcagtt
gctactaatgtctccaagcaggaggttcctgatgaaatctttgttgagccagcagtgaat
ggaaaccctaagctctgttctgataacatggtccctttcggtgcagaaccttcaggaaaa
tccgaggagtcaaagggcttgttcaaaaggcactgcaacatcatatcttccaatggaatt
ctgattgggaaggtggtccgtacattgcataattcccattcatcctgtcagaatgcagaa
gaaagatcccagcatgagctgccaaaaattgattccctaaatggtgctattagtttagat
aatgaatataaagaaaatggactgaaacttgatgattccacttgccaagtccaacctgtt
aaaccttctgagattttcttcgctaaagcaaatggagtgcttgaagcgatgcctaaacct
ttgtcaccagatcctcaaggtatcttagaatcacttacatacagccagttgaacagcttg
tcggaggaaaagagtgtctctggacctcagaaatcttctgacaatgatggagttacagat
actgtagtgatggaagcactgtttgcctatgaagaatccaggaaggttccttccaaattt
agctgtgaggttgagaaactttttactcaatcagattctgaaaccatttttaccaaagaa
gaagttgctgaaagtattataacaaaagctgataatgcacatctcaatatcaatggtcag
cacaaggttaggaaaaaatccttggatactgaaggtgaattccttggacagtgtgagtct
gaagacatcagagataaagacaaactaagaagatcaaaagaacctgaattcatttcaaaa
gaaaatcctttgtacatcaaaggatctcctgagagcaaagagaaattagggcaaatttcc
tctataaagcctgacattgaatgtagttctaaaaaacttgcatctctagatattacagat
aaatgccaagatacaaaggacatttctaataactatgtagaggtaccacctgttaatgac
tcttctattacaaagctggataaagtattggaaagtcaattttctagagcagacgaggga
ccgagtaatcaaacatgtgaagatgatggcaaacatatgaaaaaaaataagaaaaaaatc
catgactctaaaagaactgacaaagagcactaccggaggaagagagaaaactcggacact
gaggagaaggagaggcaaaccagaaacaaatcagatgatcattcccacaggaggaggagc
tctcacagtgtggaaacaaacaagcagagccgtcataagcaggagtattgcagtgagagc
aagtacagatcctcccacagtgaaagaaacactctcagcaatggtaggagctcaggaaag
tattcccgttacagatcccgaagcagagaaaggacagatccagacagaaacaggtattat
tattccaaaggagacaggccttggattagagaaagatactaccaagatgaaccacggaga
tgggaaaagtgcaggtactacaatgattattattcctcccatggaacaagggatggcagg
gagaggaggtcctctcattgtgataaagactatgacaaatcgagccaggcttacagcagg
tcacacaaggattatcactgcaaaagcagatgggctcacagcacactctcccgagaggag
gatgtgcatcacttcagcagccacagagcaaacttccaccattgttcagtacctcagcag
cactcggaaaaatactcccatgaaaggcacacacttccaccagtgtcagctcactcaaat
tttgaggactcttcccgggaaaatgaaaaagaaaaactaagaaatggcaaaagaaaatac
tcccaccaagaagaaagtggaagtgacatagaaaagaaatgccgaaagacagatgaccaa
agaatcaaaaagtataagaaggtcaagaagaaaaagaagtccaaagataaacatcgagag
aaggattacaaactttatgatttggattgctctgtgctccactttgacaatgacaatcgc
aaacataagaaaaagaagaaaaagaagaagcacgacaggaaactgaaagacttattggaa
tatttagatcctcgtttccagaagaaaacgtgggagaagaaggaagaatcccgtcctcca
gatgac

DBGET integrated database retrieval system