KEGG   Taeniopygia guttata (zebra finch): 100220325Help
Entry
100220325         CDS       T01082                                 

Gene name
USP42
Definition
(RefSeq) ubiquitin specific peptidase 42
  KO
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100220325 (USP42)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100220325 (USP42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 1311 aa AA seqDB search
MKPRTKKMTSRTASLGRVPPTEDPNKVSVDKGPGGHIYCRSSQKSKPFAQRDLVVNDGIA
PPQRILFPPEKICMDWQQTQSVGVGLQNLGNTCFLNSTLQCLTYTPPLANYMLSLEHTKS
CHVEGFCMMCTMESHINQVLCCSNNAIKPTSVINGLKRIGKHFHFGSQEDAHEFLCFTVD
ALQKACLNGSTKLDRSSQATTLIYQIFGGYLRSRVKCLNCKAVSDTYEPFLDVTLDIKAV
TSVTRALEQFVKPEQLDGENSYKCSKCKKMVPASKRYTIHRSSNVLTISLKRFANFTGGK
INKDVKYPEYLDLRAYMSQSIGEPLIYALYAVLVHSGFNCNAGHYLCFIKAGNGLWYRMN
DASVELSDIKTVLNQQAYVLFYIRRYDLTLGERAFYLPTPSYPRSFLGQRGANSKQAAFM
GPRLPPHMIKSSSRLNGNGPLKEDPSAVGVAVKRPSSAPPTACVQNWAISRPSMTDPSKT
QKITISIHNKLPTRQAVPQAECPSSAREEEDLKPLPSATITNSSAAEPTSNLSTVSVATN
VSKQEVPDEIFVEPAVNGNPKLCSDNMVPFGAEPSGKSEESKGLFKRHCNIISSNGILIG
KVVRTLHNSHSSCQNAEERSQHELPKIDSLNGAISLDNEYKENGLKLDDSTCQVQPVKPS
EIFFAKANGVLEAMPKPLSPDPQGILESLTYSQLNSLSEEKSVSGPQKSSDNDGVTDTVV
MEALFAYEESRKVPSKFSCEVEKLFTQSDSETIFTKEEVAESIITKADNAHLNINGQHKV
RKKSLDTEGEFLGQCESEDIRDKDKLRRSKEPEFISKENPLYIKGSPESKEKLGQISSIK
PDIECSSKKLASLDITDKCQDTKDISNNYVEVPPVNDSSITKLDKVLESQFSRADEGPSN
QTCEDDGKHMKKNKKKIHDSKRTDKEHYRRKRENSDTEEKERQTRNKSDDHSHRRRSSHS
VETNKQSRHKQEYCSESKYRSSHSERNTLSNGRSSGKYSRYRSRSRERTDPDRNRYYYSK
GDRPWIRERYYQDEPRRWEKCRYYNDYYSSHGTRDGRERRSSHCDKDYDKSSQAYSRSHK
DYHCKSRWAHSTLSREEDVHHFSSHRANFHHCSVPQQHSEKYSHERHTLPPVSAHSNFED
SSRENEKEKLRNGKRKYSHQEESGSDIEKKCRKTDDQRIKKYKKVKKKKKSKDKHREKDY
KLYDLDCSVLHFDNDNRKHKKKKKKKKHDRKLKDLLEYLDPRFQKKTWEKKEESRPPDDH
LCEQYRNQGSKQPYKEEKPSGAGDSKKYSSMASTEYVRDMELTDESLQYSD
NT seq 3936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccccgtactaaaaaaatgacgtctcgcactgcaagtttgggccgggtacctcct
acagaagatccaaacaaagtctctgtggacaaaggtcctggggggcatatttattgtaga
tcatctcaaaaatcaaagccttttgcccaaagagatctagttgttaatgatgggattgct
ccgccacaaagaattctttttccacctgagaaaatctgtatggattggcaacaaacacaa
agtgttggagttgggctgcagaacctcggcaacacatgtttccttaattctactctccag
tgtttgacctacacgcctcctcttgccaattacatgctttcacttgagcacaccaagtca
tgtcatgtagaaggattctgtatgatgtgcacaatggaaagtcacatcaaccaggtcctg
tgttgctctaataatgccatcaaacctacgtctgttatcaatggccttaaaagaatagga
aaacatttccactttggcagtcaagaggatgcacatgaattcttatgcttcactgttgat
gctttacagaaagcttgcttgaatggaagcaccaaattagacagatcttctcaagccacc
acacttatttatcaaatatttggaggatatctaagatctcgagtaaagtgcttgaactgc
aaagcagtgtcagatacatacgagccatttctcgacgttactttggatataaaggcagtt
acatctgtcaccagagctctagaacaatttgtgaaaccggaacagctggatggtgaaaat
agctacaagtgtagcaagtgcaaaaagatggttccagcatcaaagagatacacaatacat
cgctcttcgaatgttctcacaatatcgctgaaaagatttgcaaattttacaggtggaaag
atcaacaaggatgtaaaataccctgaatatttggatcttcgagcatatatgtcccaatcc
attggagaacccctcatctatgctttatatgcagttcttgtacatagtggcttcaactgt
aatgctggacactatctctgcttcataaaggctggtaatggactttggtaccgaatgaat
gatgcctcagtagagctttctgatatcaaaacagttctcaatcagcaagcttacgtactt
ttttatatcaggcgctacgacctgacgctgggggaacgagccttttacctgcccacaccc
tcctacccccgctccttcctgggccagcgcggggccaacagcaagcaggctgccttcatg
ggacctcggcttcctccccacatgattaagagttccagtcgtttaaatggaaatggaccc
ttaaaagaggatcccagtgctgttggtgttgctgtaaaaaggccatcttcagctccacca
acagcttgtgttcaaaactgggcaatttccaggccttcaatgacagacccttccaaaacg
cagaagatcacgatcagcattcacaacaagctgcccacacggcaggcggtgccgcaggcg
gagtgtccaagcagcgctagggaggaggaggatctgaagccccttccttcagccacaatt
acaaactcttccgcagcagagcctacctcaaacctctccacagtgtcagttgctactaat
gtctccaagcaggaggttcctgatgaaatctttgttgagccagcagtgaatggaaaccct
aagctctgttctgataacatggtccctttcggtgcagaaccttcaggaaaatccgaggag
tcaaagggcttgttcaaaaggcactgcaacatcatatcttccaatggaattctgattggg
aaggtggtccgtacattgcataattcccattcatcctgtcagaatgcagaagaaagatcc
cagcatgagctgccaaaaattgattccctaaatggtgctattagtttagataatgaatat
aaagaaaatggactgaaacttgatgattccacttgccaagtccaacctgttaaaccttct
gagattttcttcgctaaagcaaatggagtgcttgaagcgatgcctaaacctttgtcacca
gatcctcaaggtatcttagaatcacttacatacagccagttgaacagcttgtcggaggaa
aagagtgtctctggacctcagaaatcttctgacaatgatggagttacagatactgtagtg
atggaagcactgtttgcctatgaagaatccaggaaggttccttccaaatttagctgtgag
gttgagaaactttttactcaatcagattctgaaaccatttttaccaaagaagaagttgct
gaaagtattataacaaaagctgataatgcacatctcaatatcaatggtcagcacaaggtt
aggaaaaaatccttggatactgaaggtgaattccttggacagtgtgagtctgaagacatc
agagataaagacaaactaagaagatcaaaagaacctgaattcatttcaaaagaaaatcct
ttgtacatcaaaggatctcctgagagcaaagagaaattagggcaaatttcctctataaag
cctgacattgaatgtagttctaaaaaacttgcatctctagatattacagataaatgccaa
gatacaaaggacatttctaataactatgtagaggtaccacctgttaatgactcttctatt
acaaagctggataaagtattggaaagtcaattttctagagcagacgagggaccgagtaat
caaacatgtgaagatgatggcaaacatatgaaaaaaaataagaaaaaaatccatgactct
aaaagaactgacaaagagcactaccggaggaagagagaaaactcggacactgaggagaag
gagaggcaaaccagaaacaaatcagatgatcattcccacaggaggaggagctctcacagt
gtggaaacaaacaagcagagccgtcataagcaggagtattgcagtgagagcaagtacaga
tcctcccacagtgaaagaaacactctcagcaatggtaggagctcaggaaagtattcccgt
tacagatcccgaagcagagaaaggacagatccagacagaaacaggtattattattccaaa
ggagacaggccttggattagagaaagatactaccaagatgaaccacggagatgggaaaag
tgcaggtactacaatgattattattcctcccatggaacaagggatggcagggagaggagg
tcctctcattgtgataaagactatgacaaatcgagccaggcttacagcaggtcacacaag
gattatcactgcaaaagcagatgggctcacagcacactctcccgagaggaggatgtgcat
cacttcagcagccacagagcaaacttccaccattgttcagtacctcagcagcactcggaa
aaatactcccatgaaaggcacacacttccaccagtgtcagctcactcaaattttgaggac
tcttcccgggaaaatgaaaaagaaaaactaagaaatggcaaaagaaaatactcccaccaa
gaagaaagtggaagtgacatagaaaagaaatgccgaaagacagatgaccaaagaatcaaa
aagtataagaaggtcaagaagaaaaagaagtccaaagataaacatcgagagaaggattac
aaactttatgatttggattgctctgtgctccactttgacaatgacaatcgcaaacataag
aaaaagaagaaaaagaagaagcacgacaggaaactgaaagacttattggaatatttagat
cctcgtttccagaagaaaacgtgggagaagaaggaagaatcccgtcctccagatgaccat
ttatgtgagcaatacagaaaccagggcagtaaacaaccctacaaggaagagaagccttct
ggtgcaggtgacagcaagaaatacagctccatggcatccactgagtatgtcagagatatg
gagctgactgatgaaagccttcaatactcagactga

DBGET integrated database retrieval system