KEGG   Taeniopygia guttata (zebra finch): 100220334Help
Entry
100220334         CDS       T01082                                 

Gene name
TESK2
Definition
testis-specific kinase 2
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100220334 (TESK2)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: TKL group
  LISK family [OT]
   100220334 (TESK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 499 aa AA seqDB search
MDRSKRNSIAGFPPRLERAEDFDGSTGEGTASQLGRVCTSSYRALISAFSRLTRLDDFTC
EKIGSGFFSEVFKVRHRTSDQVMALKMNTLNSNRANMLKEVQLMNRLSHPNILRFMGVCV
HKGQLHALTEYINCGNLEQLLDGNQHLPWTVRVKLAYDIAMGISYLHYKGIFHRDLTSKN
CLIKHDENGYSAIVGDFGLAEKIPDHSEKLPVVGSPFWMAPEVLRDEPYNEKADVFSYGI
ILCEIIARIQADPDYLPRTENFGLDYDSFQHMVGDCPPDFLQLAFNCCNMDPKLRPSFAD
IVKTLEEMLNRLRNEDSERDRKFLNLDNNERKPKGSIDKGPGVKRLSSLDDKIPPKSPRP
RRNIWLSRSQSDIFSRKPSRKINVQDPYYTPSKGLGRKVNPFSAREDLKGGKIKFFDMPS
KSVISLVFDLHSPEAGGGLKASQSQFRQAYSTDCLRDQSFFLHQDKKRIWTVQMVQWPKR
KMGFALLRTHVEIQHVISH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggaccgaagtaagcggaattcaatagcaggatttccaccacgcttggagcgcgctgaa
gactttgatggtagcactggagaagggactgcatcccagctaggaagagtttgtacctct
tcatacagagccctgataagtgccttttccagacttactcgtcttgatgatttcacatgt
gagaaaattggctctggtttcttctctgaggtgttcaaggtaaggcacagaacttcagac
caggtaatggctttgaagatgaacacactgaacagcaacagagcaaacatgctgaaagag
gttcaacttatgaatagactctcacatccgaacatcttaaggtttatgggtgtctgtgtg
cataaaggacagctgcacgctcttacggagtacatcaattgtggtaacctggaacagcta
ctagatggcaaccagcatctaccctggacagtgagggtgaaactggcatatgacattgct
atgggaatcagttatcttcactataaaggcattttccaccgagaccttacatccaagaac
tgcttaatcaaacatgatgagaatggatactcagcaatagttggagactttggtttagca
gagaaaattcctgatcacagtgagaagttaccagttgtgggttcacccttctggatggca
ccagaagttcttagggatgagccctacaatgaaaaggcagatgtgttctcctatggcata
attctgtgtgagattatagcaagaatacaggcagacccagactatctccctcgcacagag
aattttggattagattatgattccttccagcacatggtgggagactgtcctcctgacttc
ctccagctggccttcaactgctgtaatatggatccaaagttgcgtccttcatttgctgat
attgtcaaaacactggaggaaatgttaaaccgcctgagaaatgaagactcagagagagac
agaaagttcttgaaccttgacaacaatgaaagaaaaccaaaaggatcaattgacaaagga
ccaggagtaaaacgtttgagttccttggatgataagatcccacccaagtcaccccgtccg
cggcggaatatctggttgtcacgcagccagtcggatatcttctctcgcaaaccttccagg
aagataaacgtgcaggacccctactacacaccaagcaaagggttaggccgcaaagtcaac
cccttcagtgcccgggaggacctcaaggggggaaagatcaaattctttgacatgccaagc
aagtctgtgatttccctcgtgtttgacttgcattctccagaggcaggtggaggcctgaaa
gccagccagtcccagttccggcaggcatacagcacagactgcctcagagaccagagtttc
ttcttgcaccaggacaagaagaggatatggactgttcagatggtccagtggcccaagagg
aaaatgggttttgccctgttgagaacacatgtggagatccagcatgtgatcagccattag

DBGET integrated database retrieval system