KEGG   Taeniopygia guttata (zebra finch): 100220427Help
Entry
100220427         CDS       T01082                                 

Definition
deoxycytidine kinase-like
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100220427
   00240 Pyrimidine metabolism
    100220427
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100220427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 270 aa AA seqDB search
MSTPAKRHCQSPAGSLESSFQKRLRKISIEGNIAAGKSTFVRLLEKHSDEWEIIPEPIAK
WCNIQTAEDEYEELSTSQKSGGNLLQMLYDKPTRWAYTFQTYACLSRVKAQLKPVSAKLY
EAEHPVQFFERSVYSDRYVFASNLFESGNINETEWSIYQDWHTWLLNQFQSDIELDGMIY
LRTTPQKCMERLQMRGRREEQGIELEYLENLHYKHETWLHERTMRVDFENIKEIPILVLD
VNEEFKNDKIKQEYLIDKVKSFLTSLEDGN
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtctacccccgccaagcggcactgccagagccccgccggctccctcgaatccagcttc
cagaagcgcctcaggaagatttccatcgaggggaacatcgctgcggggaagtcaacgttc
gtcaggctgctggagaaacacagcgatgagtgggagatcatccccgagcccatcgctaag
tggtgcaacatccagacagccgaggatgagtatgaggaactttcaacatctcagaagagt
ggaggaaacttacttcaaatgctgtatgataaacccacaagatgggcttacacatttcaa
acttatgcttgcttgagccgagtaaaagcacaattaaaacctgtctcagccaagctatac
gaagcagaacatccagtgcaatttttcgaaagatctgtgtacagtgacaggtatgtgttt
gcttctaacctgttcgagtctggaaatattaatgaaacagagtggtctatttatcaggac
tggcacacatggcttttgaatcagtttcaatcagatatagaactggatggcatgatatat
ctcagaaccacacctcagaaatgtatggaaaggctacagatgaggggaagaagagaggag
caaggaattgagcttgagtatttggaaaacctccactataaacatgaaacctggcttcat
gaaaggactatgagagttgattttgagaacatcaaggagattcctattctagttttggat
gttaatgaagagtttaagaatgataaaattaaacaagagtacctgattgataaagtcaag
tcattcctgacttctttagaagatggaaattaa

DBGET integrated database retrieval system