KEGG   Taeniopygia guttata (zebra finch): 100220619Help
Entry
100220619         CDS       T01082                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
tgu04060  Cytokine-cytokine receptor interaction
tgu04068  FoxO signaling pathway
tgu04144  Endocytosis
tgu04218  Cellular senescence
tgu04350  TGF-beta signaling pathway
tgu04520  Adherens junction
tgu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100220619 (TGFBR2)
   04350 TGF-beta signaling pathway
    100220619 (TGFBR2)
   04068 FoxO signaling pathway
    100220619 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100220619 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100220619 (TGFBR2)
  Cell growth and death
   04218 Cellular senescence
    100220619 (TGFBR2)
  Cellular community - eukaryotes
   04520 Adherens junction
    100220619 (TGFBR2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100220619 (TGFBR2)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100220619 (TGFBR2)
Protein kinases [BR:tgu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100220619 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase_Tyr Pkinase APH
Motif
Other DBs
NCBI-GeneID: 100220619
NCBI-ProteinID: XP_012427091
Ensembl: ENSTGUG00000003590
Position
2
AA seq 547 aa AA seqDB search
MGSSVPALLRAEFTSPVERNKEGGLKMPNLCKFCDIKVTTCSNQHQCKSNCNITSICEKS
SEVCVAIWRQNDENVTLETICHDPQETLYGHFLDDYKSEQCLMREKKDDGGLMFMCSCTG
EECNDMLIFTSDDPHKPEEKDEISKVTIISLVPLLVISVAVIVIFYAYRTHKKRKLSKAW
EKNVKPKKHKDCSDVCAIMLDDDRSDISSTCANNINHNTELLPIELDVVVGKGRFAEVYK
AKLKQNTSEQYETVAVKIFSYEEYASWKTEKDIFSDVNLKHENILQFLTAEERKTDLGKQ
YWLITAFHAKGNLQEYLTRHIISWEDLWKLGGSLARGIAHLHSDHTPCGRPKTPIVHRDL
KSSNILVKNDLTCCLCDFGLSLRLDPSLSVDDLANSGQVGTARYMAPEVLESRMNLENME
SFKQTDVYSMALVLWEMTSRCNAVGEVKEYEPPFGSKVREHPCVESMKDNVLRDRGRPEI
PSSWLNHQGIQMVCETLIECWDHDPEARLTAQCVAERFSELKHHDRLSGRSCSEEKIPED
GSVTTAK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgggcagctcggtccccgctctgctccgggctgaatttacatcacctgtggaaagaaat
aaggaaggtggactgaaaatgccaaacctatgcaaattttgtgatattaaagtaacaacc
tgctcaaaccaacatcagtgcaagagcaactgtaacatcacttctatctgtgagaagagt
agtgaagtctgtgttgccatatggagacagaatgatgaaaatgtgacattagaaacaata
tgccacgatccccaagaaacactgtatggtcactttttggatgactataaatcagagcag
tgtttgatgagggaaaagaaggatgatgggggattgatgttcatgtgttcctgcacaggt
gaagaatgcaatgatatgctcatttttacatcagatgaccctcataagccagaggagaaa
gatgaaatttccaaagtcacaatcataagtcttgtcccgttactggtgatttctgttgct
gtgattgttatcttttatgcctaccgcactcacaagaagaggaaactcagcaaggcatgg
gagaagaatgttaagcccaagaagcataaggactgcagtgatgtctgtgccattatgtta
gatgacgaccgctcagacatcagctccacgtgtgccaacaacatcaaccacaacacagag
ctgctgcccattgagttggacgttgttgttggcaaaggaaggtttgctgaagtgtataaa
gccaaattgaagcaaaacacatcagaacagtatgaaactgtggcagtcaagattttctcc
tatgaagaatatgcttcctggaaaactgagaaagacattttttcagatgtaaacctcaag
catgagaacatactccagttcttgacagcagaggagcgtaagacagatcttggcaaacaa
tattggttgatcactgccttccatgctaaaggaaacttgcaggaatatctcacacggcac
attatcagctgggaggacctctggaaacttggcgggtccttggcccgagggattgcccat
ctacacagtgatcacacaccctgtggtcgtcccaaaacaccaatcgtacatagagaccta
aagagttccaacatcctggtgaaaaatgatttaacctgctgtctctgtgactttgggtta
tccctgaggctggacccttccttgtctgtggatgacttagctaacagtgggcaggtgggc
acagcaagatatatggcccctgaggttttggagtccaggatgaacctggagaacatggag
tccttcaaacaaacagatgtgtactccatggctttggtcctctgggaaatgacatctcgc
tgtaatgctgtcggagaagtgaaagagtatgagcccccattcggctccaaagtgcgagaa
cacccttgtgtggaaagcatgaaggacaatgtcctgagagacagagggcgacctgagatc
cccagctcctggcttaaccatcagggcatccagatggtgtgtgaaaccctcattgagtgc
tgggaccacgaccccgaggcccggctgacggcacagtgcgtggccgagcgcttcagcgag
ctcaagcaccacgaccggctctcggggaggagctgctcagaggagaagattcccgaggat
ggctccgtgaccactgcgaagtag

DBGET integrated database retrieval system