KEGG   Taeniopygia guttata (zebra finch): 100220619Help
Entry
100220619         CDS       T01082                                 

Gene name
TGFBR2
Definition
transforming growth factor, beta receptor II (70/80kDa)
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100220619 (TGFBR2)
   04350 TGF-beta signaling pathway
    100220619 (TGFBR2)
   04068 FoxO signaling pathway
    100220619 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100220619 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100220619 (TGFBR2)
  Cellular commiunity
   04520 Adherens junction
    100220619 (TGFBR2)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100220619 (TGFBR2)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   100220619 (TGFBR2)
Enzyme-linked receptors [BR:tgu01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   100220619 (TGFBR2)
Cytokine receptors [BR:tgu04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   100220619 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 556 aa AA seqDB search
MFILTKFDSKRDSAVTSFDAEFTSPVERNKEGGLKMPNLCKFCDIKVTTCSNQHQCKSNC
NITSICEKSSEVCVAIWRQNDENVTLETICHDPQETLYGHFLDDYKSEQCLMREKKDDGG
LMFMCSCTGEECNDMLIFTSDDPHKPEEKDEISKVTIISLVPLLVISVAVIVIFYAYRTH
KKRKLSKAWEKNVKPKKHKDCSDVCAIMLDDDRSDISSTCANNINHNTELLPIELDVVVG
KGRFAEVYKAKLKQNTSEQYETVAVKIFSYEEYASWKTEKDIFSDVNLKHENILQFLTAE
ERKTDLGKQYWLITAFHAKGNLQEYLTRHIISWEDLWKLGGSLARGIAHLHSDHTPCGRP
KTPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPSLSVDDLANSGQVGTARYMAPEVLE
SRMNLENMESFKQTDVYSMALVLWEMTSRCNAVGEVKEYEPPFGSKVREHPCVESMKDNV
LRDRGRPEIPSSWLNHQGIQMVCETLIECWDHDPEARLTAQCVAERFSELKHHDRLSGRS
CSEEKIPEDGSVTTAK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtttattttgacaaagttcgatagtaaacgtgacagtgctgtaacaagctttgatgct
gaatttacatcacctgtggaaagaaataaggaaggtggactgaaaatgccaaacctatgc
aaattttgtgatattaaagtaacaacctgctcaaaccaacatcagtgcaagagcaactgt
aacatcacttctatctgtgagaagagtagtgaagtctgtgttgccatatggagacagaat
gatgaaaatgtgacattagaaacaatatgccacgatccccaagaaacactgtatggtcac
tttttggatgactataaatcagagcagtgtttgatgagggaaaagaaggatgatggggga
ttgatgttcatgtgttcctgcacaggtgaagaatgcaatgatatgctcatttttacatca
gatgaccctcataagccagaggagaaagatgaaatttccaaagtcacaatcataagtctt
gtcccgttactggtgatttctgttgctgtgattgttatcttttatgcctaccgcactcac
aagaagaggaaactcagcaaggcatgggagaagaatgttaagcccaagaagcataaggac
tgcagtgatgtctgtgccattatgttagatgacgaccgctcagacatcagctccacgtgt
gccaacaacatcaaccacaacacagagctgctgcccattgagttggacgttgttgttggc
aaaggaaggtttgctgaagtgtataaagccaaattgaagcaaaacacatcagaacagtat
gaaactgtggcagtcaagattttctcctatgaagaatatgcttcctggaaaactgagaaa
gacattttttcagatgtaaacctcaagcatgagaacatactccagttcttgacagcagag
gagcgtaagacagatcttggcaaacaatattggttgatcactgccttccatgctaaagga
aacttgcaggaatatctcacacggcacattatcagctgggaggacctctggaaacttggc
gggtccttggcccgagggattgcccatctacacagtgatcacacaccctgtggtcgtccc
aaaacaccaatcgtacatagagacctaaagagttccaacatcctggtgaaaaatgattta
acctgctgtctctgtgactttgggttatccctgaggctggacccttccttgtctgtggat
gacttagctaacagtgggcaggtgggcacagcaagatatatggcccctgaggttttggag
tccaggatgaacctggagaacatggagtccttcaaacaaacagatgtgtactccatggct
ttggtcctctgggaaatgacatctcgctgtaatgctgtcggagaagtgaaagagtatgag
cccccattcggctccaaagtgcgagaacacccttgtgtggaaagcatgaaggacaatgtc
ctgagagacagagggcgacctgagatccccagctcctggcttaaccatcagggcatccag
atggtgtgtgaaaccctcattgagtgctgggaccacgaccccgaggcccggctgacggca
cagtgcgtggccgagcgcttcagcgagctcaagcaccacgaccggctctcggggaggagc
tgctcagaggagaagattcccgaggatggctccgtgaccactgcgaagtag

DBGET integrated database retrieval system