KEGG   Taeniopygia guttata (zebra finch): 100220635Help
Entry
100220635         CDS       T01082                                 

Gene name
HDAC9
Definition
histone deacetylase 9
Orthology
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100220635 (HDAC9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1230 aa AA seqDB search
MQAPITRPCLTYFWLRPAIVLFLPPLGQEGVNSNANELSLLLPPTSPSRLAEGQPAGSER
GAGTAAKPKAQRYFFISSSTCRWLPERNCSNSAALSAPHAHGSLPAGGGCRRWIWAFPLL
IDTCANAQTLLIAEAHYLTTLAEGDGVSGREQLLAQQRMHSMISSVDVKSEVPVGLEPIS
PLDLRTDLRMMVPMVDPIMREKQLQQELLLIQQQQQIHKQLLIAEFQKQHENLTRQHQAQ
LQEHIKLQQELLAIKQQQELLEKEQKLEQQRQEQELERHRREQQLPPLRGKERGRERAVA
STEVKQKLQEFLLSKSATKDSPANGKNHSMSRHPKLWYTAAHHTSLDQSSPPLSGASPPY
KYTLPGAQDAKDDFPLRKTASEPNLKVRSRLKQKVTERRSSPLLRRKDGXXXSGIHVCLI
CFSESSVSSSSPGSGPSSPSNGPTSSTTETETSILPSNIQAEHLVSQQRLLIQDESVNLL
SLYTSPSLPNITLGLPAIQPQISSSSSFKEKQKGETPSLRQGVALAGQYGGNIPPSSTHP
HIALEGKPNSSHQALLQHLLLKEQMRQQKLLVTGAVPLHPQSPLAAKERVSPGIRAAHKL
PRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNKMLSKSIEQLKQPGS
HLEEAEEELHGDHSMQEERAPSSSASVRAESSSAGVDERIGQQVGAVKVKEEPLDSDEDV
QTQQMESGEQAAFMQQEFLAHRHVHQLQIYQAQMATVGMAGSDKHRPLSRTPSSPTDSTL
PHPDMDQPSQHVYTTGVVYDSLMLKHQCMCGNYTNHPEHAGRIQSIWSRLQETGLLNKCE
RIRGRKASLEEIQLVHSEHHSLLYGTSPLNRQKLDPRKLLGSVSQKLFSLLPCGGLGVTS
DIKWSEMAFSTCYSXSIGCSLKASFEVSEGEMGNGFAVVRPPGHHAEESTAMGFCFFNSI
AITAKYLRDKLNIGKILIVDLDVHHGNGTQQAFYADPSILYVSLHRYDEGNFFPGSGAPN
EVGSGPGEGYNINIAWTGGLDPPMGDVEYLTAFRTVIMPAANEFDPEIVLVSAGFDAVEG
HDPPLGGYKVTAKCFGHLTKQLLKLADGRVVLALEGGHDLTAICDASEACINALLGNELE
PLPEDIVHQIPNMNAIASLKKTTEIQSKYWKSVEPYSVPVDCALAESQKQEREETETVSA
MASLSVDVEQCIPQEGSRAAGEPMEEEPAL
NT seq 3693 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctccaatcacccggccatgcttgacctatttttggctcaggccggccattgtt
ctatttctgccgccgctgggccaggagggtgtcaattcaaatgcaaatgagttatcgctg
ctgctcccgccaacttcgcccagccgcctggcagagggacagccggccgggagcgagagg
ggcgcgggcacggcagcgaagcccaaagcgcagagatatttcttcatttcttcttccacc
tgccgctggctgcccgaacgcaactgctcaaactcggcagcgctcagcgccccgcacgct
cacggctcccttcctgcgggcgggggctgccgacggtggatttgggcttttcctctcctc
atagatacttgtgcaaatgctcaaacactgctaattgccgaagcacattatcttacaacc
ctcgctgaaggagatggggtttctggacgtgaacagctcttggctcagcaaagaatgcac
agtatgatcagctcagtggatgtgaagtcggaggttcccgtgggcctggagccgatctca
cccttagacttgcgaacggatctcaggatgatggttcccatggtggacccaattatgcgc
gaaaagcagctccagcaggagctgctcctgatccagcagcaacagcagattcacaaacaa
ctgctcattgcagagttccagaagcagcatgaaaatctgacccgccagcatcaggcccag
ctccaggagcacattaagttacaacaggaactactagccattaaacaacagcaagaactc
cttgaaaaagagcagaaactggagcagcaaagacaagagcaggaactggagaggcatcgc
agggagcaacagcttcctcccctccgaggcaaagaaagaggacgagaaagggcagtggcc
agtacagaagtgaagcagaaacttcaagagttcctgttaagtaaatcagctacaaaagac
tctccagcaaatgggaagaatcattccatgagccgtcaccccaagctctggtacacggct
gcccaccatacctcactggatcaaagctctccacccctgagtggggcctcgccaccatac
aaatatactttaccaggagcacaggatgctaaggatgattttccacttcgtaaaacggct
tcagagcccaatttgaaggtacgttcaagattaaaacaaaaggtgacagaaaggagaagc
agtcctttacttaggaggaaggatggnnnnnnnnagagtggaattcatgtatgtttaatc
tgtttttcagaatcctcagtcagtagcagctcccctggatcaggtcccagttccccaagc
aatggtccgaccagcagtacaacagaaactgaaacttcaattttgccatctaatattcaa
gctgagcacctggtttcccagcaacgcctcttaatacaggatgaatcagtgaacttgttg
agtctgtacacatctccttctctgcccaacattaccttgggccttccagcaatacaacct
caaatcagttcttcgtcgtcattcaaagaaaagcagaagggggagaccccatcactaaga
caaggagtggccttggccggacagtatggaggaaacattcctccatcatcaactcatcct
cacattgctttggaaggaaagccaaacagcagccaccaagctctcttgcagcatctgtta
ctgaaagaacaaatgagacagcaaaaacttcttgtgactggagcggttcctcttcatcca
cagtctcctttagcagcaaaggagagagtctcacctggcataagagctgcccacaaactg
cctcgtcacaggccactgaacagaacccagtcagctcctcttcctcagagtaccttggcc
cagctggtcatccagcagcaacatcagcaatttttggagaagcagaagcagtaccagcag
cagatccacatgaataagatgctctctaagtccattgagcagctcaagcagcctggcagt
cacctggaggaagctgaagaagagcttcatggagatcactcaatgcaggaagagcgagct
ccctccagcagtgccagcgttagggctgagagcagcagtgctggtgtggatgaaagaata
ggacagcaggtgggggctgtgaaagtcaaagaggagccactggacagtgatgaggatgtt
caaacccagcaaatggaatctggggagcaagctgcttttatgcaacaggagttcctggca
catcggcatgtccaccagttgcaaatctaccaggctcagatggctacagttggcatggca
ggatcagataaacatcgaccactttccaggaccccatcttcccccactgactccacatta
cctcacccagacatggaccagcccagccagcatgtctacacaactggtgtcgtgtatgac
agtctgatgctgaagcaccagtgcatgtgtgggaactacactaatcaccccgaacacgct
ggaagaatccaaagcatctggtcaaggctgcaagaaactgggttgctaaacaagtgcgag
cgaattcgaggtcgaaaagccagtctggaggaaatacagctggttcactctgaacatcat
tcactgctgtatggcaccagcccactgaacagacagaagctggaccccaggaaactccta
ggaagcgtgtctcaaaaactcttttccttgttgccttgtgggggacttggggtaacatct
gatataaaatggagtgaaatggcattttctacttgttacagctaaagcattggctgcagt
ttaaaagcaagttttgaggtttccgaaggggagatgggaaatggctttgctgttgtaagg
cccccaggccatcatgctgaagaatcaacagccatggggttctgcttttttaattcgatt
gcaattactgccaaatacttgagagacaagctaaatataggcaagatattgattgtagat
ctggatgttcaccatggcaacggtacacagcaggctttttatgctgaccccagcatcctg
tatgtttccctccatcgctatgatgaaggcaacttcttccccggcagtggagccccaaat
gaggttggaagtggccctggtgaagggtataacataaatattgcttggacaggtggcttg
gatcctcctatgggtgatgttgagtatctcacagcattcagaactgtgattatgccagct
gccaatgagtttgatccagaaattgtcctggtgtcagcaggattcgatgctgtggaaggc
cacgaccctccgctgggcgggtacaaagtcacagctaaatgttttggtcacctgaccaag
caattgctgaagctggcggacggccgcgtggtgctggcgctggagggaggccatgacctt
actgccatctgtgacgcctctgaagcctgtataaatgccctcctaggaaatgagctggag
cctctcccggaagatattgtgcaccaaatccccaatatgaatgcaatagcttctttaaaa
aagaccactgaaattcaaagcaagtactggaagtcagtggaaccatactctgtgccagtg
gattgtgctctggctgagtctcagaagcaagagagggaggagacagaaacagtatcagct
atggcctctctgtcagtggatgttgagcagtgtattcctcaggaaggcagcagagctgct
ggtgagcccatggaagaagagccagccttgtga

DBGET integrated database retrieval system