KEGG   Taeniopygia guttata (zebra finch): 100220657Help
Entry
100220657         CDS       T01082                                 

Gene name
BDH2
Definition
3-hydroxybutyrate dehydrogenase, type 2
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tgu00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:tgu00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 245 aa AA seqDB search
MGRLDGKIILLSAAAQGIGRAAAIAFAKEGAKVIATDINESKLQELGKCPGIQVRVLDVT
KKEQIENLAKEIEKIDVLCNIAGFVHHGTILECEEQDWDFTMNVNVRSMYLMIKTFLPKM
LKQKSGNIINMSSVASSIKGVVNRCVYSTSKAAVIGLTKAVAADFIEQGIRCNCICPGTV
DTPSLQERIQARPNPEQALKDFLARQKTGRMATAEEVAHLFVYLASDESAYVTGNELIID
GGWSL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggggcggctggatgggaagatcatccttttgtctgcagcagcacagggcattggccga
gcagctgctattgcttttgctaaagaaggagccaaagtcattgctacagacatcaatgag
tcaaaactgcaagaactggggaaatgtccaggcattcaagtacgggttctggatgtcacc
aaaaaggagcagatcgaaaatctggccaaggagattgaaaagattgacgtcctctgtaac
attgcagggtttgttcatcatggaaccattctggagtgtgaggagcaagactgggacttc
acgatgaacgtcaatgttcgcagcatgtacctaatgataaagacattccttccaaagatg
cttaaacagaaatctggaaatattataaatatgtcttctgtggcatctagcatcaaagga
gttgtgaacaggtgtgtctacagtacttcaaaggcagcagttattgggctaacaaaggct
gtagctgctgatttcattgaacaaggcatccgatgcaactgcatatgtcctggaactgtt
gacacaccatctttacaggaaagaatccaagcccggcctaatccagaacaggcactgaaa
gactttctagccagacagaaaactggcaggatggctactgcagaagaagtggcccatctc
tttgtgtacttggcttctgacgaatctgcctatgtgactggtaatgaattaatcatcgat
ggaggatggagcttgtga

DBGET integrated database retrieval system