KEGG   Taeniopygia guttata (zebra finch): 100220830Help
Entry
100220830         CDS       T01082                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Cell cycle
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100220830 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100220830 (HDAC1)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100220830 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
23
AA seq 470 aa AA seqDB search
MALTQGTKRKVCYYYDGEGLRAPLQGCRAAGEPSRGGEEWGAEGASRTEEAGVRGDVGNY
YYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPD
NMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKQQTDIAVNWAGGLHHA
KKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYG
EYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVISKVMETFQPSAVVLQCG
SDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDT
EIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQ
PIPEDAVQEDSGDEEEDDPEKRISSRCWELNCAGKSPKLSSILELFTRRM
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgacgcagggcacgaagcgcaaagtctgctactactacgatggtgaggggctg
cgggcaccccttcagggctgccgggccgcgggggagccgtcccggggcggggaggagtgg
ggggctgagggggcatcgcggacggaggaggcgggggtgaggggggatgttgggaattat
tattatggccaaggacatcccatgaaaccccacaggatccgcatgacccacaacctcctg
ctcaactatgggctctacaggaagatggagatctatcgtcctcacaaggccaatgcagag
gagatgaccaagtaccacagcgatgattacatcaaattcctgaggtccatccgccctgac
aacatgtctgagtacagcaagcagatgcagagatttaatgttggggaggactgccctgtg
tttgatgggctctttgagttctgtcagctctctgctggaggctctgttgccagcgcggtg
aagctgaacaagcagcagacggacatcgcagtgaactgggctgggggcctccaccacgcc
aagaaatccgaagcgtccggcttctgctacgtcaacgacatcgtcctggccatcctggag
ctgctcaagtaccaccagcgggtgctgtacattgacattgacatccaccacggggacggg
gtggaggaggctttttacaccacagacagggtcatgaccgtgtccttccacaaatacgga
gaatatttcccaggaactggggacctgagggacatcggggcaggcaaagggaagtattac
gctgtcaattacccgctgcgggacggcatcgatgacgagtcctacgaagccattttcaaa
cctgtgatctccaaggtgatggagacgttccagcccagcgccgttgtcctgcagtgcggc
tccgattccctgtctggggacaggctgggctgcttcaacctcaccatcaaaggccacgcc
aagtgtgtggagtttgtgaagagctttaacctgcccatgctgatgctgggaggagggggg
tacacgatccgcaacgtggctcgctgctggacctacgagaccgctgtggctctggacact
gagattcccaatgaacttccatacaacgactactttgagtactttgggccagacttcaag
ctgcacatcagcccctccaacatgaccaaccagaacaccaacgaatacctggagaaaatc
aagcagcggctcttcgaaaacctgaggatgctccctcacgctcctggggtccagatgcag
ccaattcctgaggacgctgtgcaggaagacagcggggatgaggaggaggatgatcctgaa
aaacgcatttccagtaggtgctgggaattgaattgtgctgggaaaagcccaaagctgagc
agcatccttgagctcttcacgaggaggatgtag

DBGET integrated database retrieval system