KEGG   Taeniopygia guttata (zebra finch): 100221053Help
Entry
100221053         CDS       T01082                                 

Definition
uncharacterized LOC100221053
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tgu00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 775 aa AA seqDB search
MERYHWRLLPQGLKCSPTICQRYVASLLTPVRAATEGMSIQHYMDDILICAPNSDLLTHA
LNLTTDALVAAGFELREDKIQKMPPWKYLALEITIVPQKLAIKNKIQTLADVQQVCGSLN
WPEPQPGALPAGSQLGGIPSDPAAPPYPSAPLSPGTLPVPSARSSPRLPLPSQPGDTRYP
PPRGTHCSHLIPGTPVHPQPGVSRGIPLCRALIAGTPSMAGGDMAAAAANGGGAGGIKAG
TAEGEQGRPGGCGAVARLGHGCGTARAQLPARPMEAARGWNGFPRRERPPPSPPAAAEKP
RVPRGRRYRYLWGWWPLNKQKLKALQKLVAKQLAKGHIQETTSPWNSPIFVLKKPGKNEW
RLLHDLRATNNVIENMGPLQPGMPSPTMLPKDWELAVIDIKNCFFHIPLHPEDTPRFAFS
VPSTNREAPVERYHWRVLPQGLKCSPTICQRYVASLLTPVRAATEGVIIQHYMDDILICA
PNGDLLTHALNLTTDALIAAGFELRKDKIQKMPPWKYLALEINIVPQKLAIKNKIQTLAD
VQQLCGSLNWKAELQLKDKQIAKQTVDEEFVRRVNMNKLFLESFKYLMNPRANNYRIFGH
KSSFGPAAVSAAASCAAPLVILIQLSAWPACELDQQVACDVLNDAIFDEDHDEMVIVKDI
DMFSLCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAIAITE
ALQPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggagcggtaccattggcgactgttgccacagggcctcaaatgctcacccaccatctgc
cagaggtacgtggcttcattgctgaccccagtccgtgcagccaccgagggcatgagcatc
cagcactatatggatgatatcttaatttgtgctcccaacagcgatctccttacacatgcg
cttaacctgacaaccgatgcgttggttgctgcagggtttgagctgcgagaagacaaaatt
caaaagatgccaccctggaagtacctggctttggaaattaccattgttccacaaaaattg
gccattaaaaataaaattcagaccctagcagatgtccagcaggtgtgtggttctttgaac
tggccagaacctcagcccggggctctccctgctggatctcagctcggggggatcccctct
gatccagcagcacccccgtaccccagcgcacccctcagcccaggaaccctcccggtaccc
tcagcccggagctcccctcggctcccgctgccctcgcagccgggggatacgcggtatcct
cctccccggggtacccactgctcacacctcatcccagggacccccgtgcacccccagccc
ggtgtgagccgggggatccccctgtgccgtgccctcatcgcgggcaccccctccatggcg
ggcggtgacatggcggcggcggcggccaatgggggcggcgcgggcggtataaaagccggg
acggctgagggcgagcagggccggcccgggggctgcggagctgtggcacggctcgggcac
ggctgtggcacggctcgggcacagctcccagcgcggcccatggaggcggcgcggggctgg
aacgggttcccgcggcgggagcggccgccgccctccccgcccgcggccgcggagaagccg
cgggtcccccgcgggcgccggtaccggtacctgtggggatggtggccgctcaacaaacaa
aaattaaaagcgctccagaagctcgtggcaaagcaacttgccaaggggcatatccaagaa
acaacatctccttggaattcccccatctttgtcctgaaaaaacctggcaagaacgaatgg
cggctccttcacgacctccgtgctaccaacaatgtcattgagaatatgggtccccttcaa
ccagggatgccgtcccccacgatgttgccaaaagattgggaattggctgtcattgacata
aaaaattgcttcttccacattcccctacaccctgaagacacaccacgttttgccttctcg
gttccctccaccaaccgagaagccccagtggagcggtaccattggcgagtgttgccacag
ggcctcaaatgctcacccaccatctgccagcggtacgtagcttcattgctgacccccgtc
cgtgcagccactgagggcgtgatcatccagcactatatggatgacatcttgatttgtgct
cccaacggcgatctccttacacacgcgcttaacctgacaaccgatgcgttgattgctgca
gggtttgagctgcgaaaagacaaaattcaaaagatgccaccctggaagtacctggctttg
gaaattaacattgttccacaaaaattggccattaaaaataaaattcagaccctagctgac
gtccagcagctgtgcggttctttgaactggaaggcagagctgcagctgaaggacaagcag
atagcaaagcaaacggtggatgaagagtttgttaggagagtcaatatgaacaaactcttt
ttagagagttttaaatacctgatgaaccctagagccaacaactacagaatatttgggcac
aagagtagctttggacctgctgctgtctctgctgcagcatcctgtgctgctcccttggtt
atactaatccagctgtctgcctggccagcctgtgaactggaccagcaagtggcttgtgat
gtcctgaacgacgccatctttgacgaagaccatgatgagatggtaattgtgaaggacata
gacatgttctcattgtgtgagcatcacctcgttccatttgttggaaaggtacacattggt
tatcttcccaacaaacaagtgcttggcctcagcaagctcgctaggatcgtggaaatatac
agtagaagattacaagtccaggagcgccttaccaaacaaatcgccatcgccatcacagaa
gccttacagcccgccggggtcggcgtcgtcgtggaagccacgcacatgtgcatggtcatg
cgtggggtgcagaaaatgaacagtaaaacagtgaccagcacaatgctgggggtattccgg
gaagatccaaagacccgcgaagaattcctgacgctcatcaggagctga

DBGET integrated database retrieval system