KEGG   Taeniopygia guttata (zebra finch): 100221090Help
Entry
100221090         CDS       T01082                                 

Definition
eukaryotic translation initiation factor 4E type 2-like
Orthology
K03259  
translation initiation factor 4E
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100221090
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100221090
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100221090
Translation factors [BR:tgu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100221090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 234 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENNTQKDSEKEKNDREKPQSTTKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKDNSSFRNTKITL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaattcgacgcattgaaagatgatgatagtggagaccatgaccagaatgag
gaaaataacacacagaaagacagtgagaaggaaaagaacgatcgtgagaaaccacagagt
actaccaagaggaaggctgtggtgccggggccagctgagcaccccttgcagtacaactac
accttctggtactcacggcgcacgcccgggcggcccaccagctcacagagctacgagcag
aacatcaaacagatcggcacctttgcctccgtggaacagttctggcggttttacagtcac
atggtacgtcctggggacctgacaggccacagtgacttccatcttttcaaagagggcatc
aaacccatgtgggaggatgatgccaacaaaaatggtggtaaatggattatccgtctgcgg
aagggcttagcatcacggtgctgggagaatcttattctggccatgttgggagagcagttc
atggtgggggaagaaatctgtggggccgtcgtctctgtccgattccaggaggacatcatc
tccatatggaacaagacagccagcgaccaggccacgacagcccggatacgcgacacgtta
cgaagagtgctcaacctacctcccaacaccatcatggaatataaaacccacaccgacagc
atcaaggataattcaagctttcgaaacacaaaaatcacattgtga

DBGET integrated database retrieval system