KEGG   Taeniopygia guttata (zebra finch): 100221157Help
Entry
100221157         CDS       T01082                                 

Definition
trypsin I-P1-like
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Neuroactive ligand-receptor interaction
Influenza A
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:tgu04080]
Human Diseases; Infectious diseases; Influenza A [PATH:tgu05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 249 aa AA seqDB search
MKCLLLLAFIGVAVAFPTFAEDDDDKIVGGYTCGKNAVPYQVSLNSGYHFCGGSLISSQW
VVSAAHCYKSRIQVQLGKHNLETTESTQQLINSAKVIRHSGYSPYTLDNDIMLIKLATPA
TLNKAVQTIPLPTRCVATGTTCLISGWGNTLSSGSNYPDQLQCLNAPVLSAAECSDAYPG
EITNNMMCVGFMEGGKDSCQGDSGGPVVCNGELQGIVSWGLGCAQEGYPGVYTKVCNYVS
WIQSTIASH
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcctgctgcttctcgcctttattggggtggctgttgccttccccacctttgct
gaagatgacgatgacaagattgtgggaggctacacctgtggaaagaacgctgtgccctat
caagtgtccctgaattctggatatcacttctgtggaggttccctcatcagcagccagtgg
gtcgtgtcagctgctcactgctacaaatctcgcatccaagtgcagctcgggaaacacaac
ctggaaaccaccgaatccacacagcagttgatcaactctgctaaagtcatccgccactct
ggctacagcccctacaccctggacaatgacatcatgctcatcaagctggccaccccagcc
acgctcaacaaagctgtccaaaccattcctctgcctaccagatgcgtggccaccggcacc
acctgcctgatctccggctggggcaacactctcagcagtggctccaactacccggaccaa
ttgcagtgcctgaatgctccggtcctctccgctgctgagtgctctgatgcctaccctggg
gaaattaccaacaacatgatgtgtgtaggattcatggagggaggaaaagactcctgccag
ggagattccggcggtcctgtggtctgcaacggagagctccagggcattgtctcctggggt
ttaggatgtgcccaagagggctaccctggagtttacaccaaggtttgcaactacgtctcc
tggatccagtccaccattgcctcccactga

DBGET integrated database retrieval system