KEGG   Taeniopygia guttata (zebra finch): 100221239Help
Entry
100221239         CDS       T01082                                 

Gene name
GPX7
Definition
glutathione peroxidase 7
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100221239 (GPX7)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100221239 (GPX7)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100221239 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 210 aa AA seqDB search
MLDPEGSVEHQPASSFPKVLLIPLAMLLAIAALLLLAFSATRQKEPDFYTFKVVNIRGKL
VSLEKYRGSVSLVVNVASECGYTDSHYKALQQLQRDLGPYHFNVLAFPCNQFGQQEPDTN
KEIESFARKTYGASFPMFSKITVSGAGAIPAFKYLIDSTGEEPTWNFWKYLVDPNGKVVK
AWDSTVSVEEIRPHVTELVRKIILKKKDEL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgctggacccggagggcagtgtggagcaccagcctgcctcctccttccccaaagtcctc
ctcatccctctagccatgctcctcgcaattgcagcgctcctgctcttagccttttccgct
acgcggcagaaggagcctgatttttacactttcaaagttgtaaacatcaggggcaagctt
gtgtctctggagaagtacaggggctcggtgtctctagttgtcaatgttgcaagtgagtgt
gggtacacagacagccactacaaggccttacagcagctgcagagagacctgggcccatac
catttcaatgtgctggcattcccctgcaatcagtttgggcagcaggagccagacaccaac
aaagaaattgagagctttgcacgaaagacttatggtgcctccttccccatgttcagcaaa
atcacagtcagtggagctggtgcaattcctgccttcaagtacttaattgattctacagga
gaagaaccaacctggaacttctggaaatacctggtggaccccaatgggaaagtagtaaag
gcctgggactctactgtctctgttgaagaaataaggccacatgttacagaacttgtaagg
aaaatcatcctgaagaagaaagatgaattatga

DBGET integrated database retrieval system