KEGG   Taeniopygia guttata (zebra finch): 100221257Help
Entry
100221257         CDS       T01082                                 

Gene name
MLYCD
Definition
(RefSeq) malonyl-CoA decarboxylase
  KO
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100221257 (MLYCD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100221257 (MLYCD)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100221257 (MLYCD)
Enzymes [BR:tgu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     100221257 (MLYCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 454 aa AA seqDB search
MEELLRRSVPPLPPYETKEKAPPPAELRGAEFVRFYRALQPGPPRAELLSRLARDFGVEH
GRVAEAAAKVLQAREQRREPGALLQAEDRLRYYLSPQYRGLFQQLGRLEGGLRFLVELRA
DLMEGLASKAVDGPHVKEMNGVLKNMLSEWFCTGFLNLERVTWQSPCEVLQKISDSEAVH
PVRNWVDMKRRVGAYRRCYFFSHCAIPGEPLIVLHVALTSDISSSIQAIVKEVPPLETED
TDKITTAIFYSISLTQQGLQGVELGTHLIKRVVKELQKELPQIEAFSTLSPIPGFTKWLV
GLLSSQTKEKGRNELFTESEWQEISEITGDPTGNTLKKLLNTNEWVRSEKLSEVLHSPLM
RLCAWYLYGEKHRGYALNPVANFHLQNGSVLWRINWMGDTSPRGIGASCGMMVNYRYFLE
ETASNSALYLGSKQVRASEQVLALVAQFQQNSKL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctgctgcgccgctcggtgccgccgctgccgccctacgagaccaaggagaaa
gcaccgccgcccgccgagctgcgcggcgcggagttcgtgcgcttctaccgcgcgctgcag
cccgggccgccccgcgccgagctcctcagccgcctggcccgcgacttcggcgtggagcac
gggcgggtggccgaggccgccgccaaggtgctgcaggcccgcgagcagcgcagggagccc
ggggcgctgctgcaggccgaggaccggctccgctactacctgagcccgcagtaccgcggc
ctcttccagcagctgggccgcctggagggcgggctgcgcttcctcgtggagctcagggcc
gacctgatggaggggctggccagcaaggcggtggatgggccccacgtcaaggagatgaat
ggagttctcaagaacatgctctcagagtggttctgcacgggattcctcaacctggagcgg
gtcacctggcagtcaccttgtgaagtactccagaaaattagtgattctgaagctgtgcac
cctgtgagaaactgggttgatatgaagcgccgggttggtgcctacagaaggtgctacttc
ttttctcactgtgccatcccaggagagccactgattgtcctgcacgtggcactaaccagt
gacatctccagcagcatccaggccatagtgaaagaagtgccacctttagagacagaagat
acagacaaaatcacaacagcaattttctactccatcagtttgactcagcagggcctgcag
ggggtggaacttgggactcacctcatcaaaagagttgtcaaagagctgcagaaagaactt
cctcagatagaagctttttccacactttcacctatcccaggattcacaaaatggctcgtt
ggtctcctctcctcccagacaaaagaaaagggaaggaatgaactttttacagaatctgaa
tggcaggaaatctctgagatcactggggaccccaccggcaacacgctaaagaaactcttg
aacaccaacgagtgggtgaggtcagaaaagctgagtgaggtgctgcattcccccctgatg
agactctgtgcctggtacttgtatggggagaagcaccgaggttatgccctcaaccccgtg
gccaatttccacctgcagaatggctcggtgctctggaggatcaactggatgggggacacg
agccccaggggcatcggggcctcctgtggcatgatggtcaactacaggtatttcctggag
gagacagcctccaacagtgccctgtacctgggctccaagcaggttagagcctccgagcag
gtgctggccttggtggcccagttccagcagaacagcaagctgtag

DBGET integrated database retrieval system