KEGG   Taeniopygia guttata (zebra finch): 100221289Help
Entry
100221289         CDS       T01082                                 

Gene name
THBS2
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100221289 (THBS2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100221289 (THBS2)
  Cell communication
   04510 Focal adhesion
    100221289 (THBS2)
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100221289 (THBS2)
  Exosomal proteins of colorectal cancer cells
   100221289 (THBS2)
  Exosomal proteins of bladder cancer cells
   100221289 (THBS2)
Heparan sulfate/heparin binding proteins [BR:tgu00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100221289 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1181 aa AA seqDB search
MPGVMLKRRGLLWLTVLITLWVSSNAQDGDKEEETTFDLLQVSNINRKTVGAKVFRGPDP
TMPAYRFIRFDHIPPCKPEKLKKILKLIRQNEGFILSATLRQDRQSRGTILALEGPGISE
RQFEIISNGRANTLDLIYWVDGFQNVISLEDVDLADSQWKNLTVQITGENYNLYVGCDLI
DSFILEEPFYEQLKAESSRLYVAKGSTRENHFRGLLQNIQLIFDTSIEDVLRKKGCQRSQ
STEVNTINESTEILHLSPAVTTEYVGEKPEKAEFCDRSCEELGSMFTELTGLRIVVNNLA
DNLQKVSEENQIMWELIGPNKTMKNQPVCWQDGRVFADNESWIVDSCTKCICQDSKIVCN
QITCPAVSCADPVFVEGECCPVCSHSDDSEEGWSPWSDWTKCSVTCGSGTQMRGRSCDVT
RSACTGPHIQTRMCSFKKCDHRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPIPQM
GGKNCVGNGRETEKCEKVPCPVNGQWGPWSPWSACTVTCGGGIRERSRLCNSPEPQYGGK
PCVGDTKQHDMCNKKDCPIDGCLSNPCFPGAECNSYPDGSWSCGACPAGYLGNGTFCEDL
DECIAVSDVCFKVNQVHRCVNTNPGFHCLPCPPRYKGSQPYGVGLEVAKTEKQVCEPENP
CKDKTHSCHKSAECIYLGHFSDPMYKCECRTGYAGDGRICGEDSDLDGWPNNNLVCAANA
TYHCVKDNCPLLPNSGQEDFDKDGKGDACDEDDDNDGVEDDKDNCPLLFNPRQFDYDKDE
VGDRCDNCPYVHNPAQIDTDNNGEGDSCAVDIDGDDIFNERDNCPYVYNTDQSDTDGDGV
GDQCDNCPLMHNPDQTDADNDLVGDQCDNNEDIDEDGHQNNQDNCPYIPNANQADHDQDG
KGDACDPDDDNDGVPDDRDNCRLRYNPEQEDSDGDGRGDICKDDFDNDNVPDIYDVCPEN
NAISETDFRKFQMVPLDPKGTAQIDPNWVIRHQGKELVQTANSDPGIAVGYDEFSSVDFS
GTFYVNTDRDDDYAGFVFGYQSSSRFYVLMWKQVTQTYWEDKPTRAYGYSGVSLKVVNST
TGTGEHLRNALWHTGNTPGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGLIKVLVYEGK
QVMVDSGPIYDTTFAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3546 nt NT seq  +upstreamnt  +downstreamnt
atgccaggagttatgctgaagaggagagggttgttgtggcttactgtcttgataaccctg
tgggtttcctcaaatgctcaggatggtgacaaagaagaagagactacctttgatttactt
caagtcagtaacataaaccgaaagacagttggagcaaaggtgttccggggcccagacccc
actatgccagcatatcgtttcattcggtttgaccatatacctccatgtaaaccggagaag
ctaaaaaagatcctaaaactaatccggcagaatgagggctttatcctctcagccaccctg
aggcaagacaggcaatctagaggcacaatccttgctttagagggtcctggcatcagtgag
aggcagtttgagatcatttccaatggccgggccaacaccctggaccttatctattgggtg
gatggcttccagaacgtgatttccctggaagatgtggaccttgctgactcccagtggaag
aacctcaccgtgcagataacaggggagaactacaacctctatgttggctgtgaccttatt
gacagcttcatcctggaagagcctttctatgagcagctgaaggcagagagcagcaggctg
tacgtggcaaaagggtctactcgggagaatcatttcaggggtcttttgcaaaatattcag
ttaatctttgatacttcaatagaggatgttctgcgtaagaaaggatgccagagaagccag
tcaactgaagtgaacaccatcaatgagagcactgaaatccttcacttgagccctgcggtc
acaactgagtacgtgggtgagaaaccagagaaggcagagttctgtgaccgctcctgtgaa
gagctgggatcgatgttcacagagctcactggcctgcgcatcgtggtgaacaacctggct
gacaacctccaaaaagtgtctgaagagaaccaaattatgtgggaactgattgggcctaac
aaaacaatgaagaaccaacctgtttgctggcaggatggccgtgtctttgcagataatgaa
agctggattgtggatagctgcaccaagtgcatttgccaggattccaaaattgtgtgcaat
caaatcacctgcccagcagtttcctgtgctgatccagtttttgttgaaggtgaatgctgt
ccagtctgctctcattctgatgacagtgaggagggctggtcaccgtggtcagactggaca
aagtgctcagttacctgtggctctgggacacagatgcgaggaaggtcatgtgatgtcacc
aggagtgcttgtacaggcccacacatccaaacaaggatgtgcagctttaagaaatgcgat
catcgcatacgtcaagatggtggctggagtcactggtctccctggtcctcctgttcagtt
acctgtggagtgggaaatatcacccgcatccgcctctgcaattctcctattccccagatg
ggtgggaaaaactgtgtgggaaatgggcgtgaaacggagaagtgtgagaaggttccatgt
ccagtgaatggccagtggggtccttggtctccatggtctgcctgcactgtcacctgtgga
ggaggaattcgtgagaggtctcggctctgtaacagtccagagccacagtatggaggaaag
ccctgtgtgggagataccaagcaacatgatatgtgcaataagaaggattgcccgattgat
gggtgtttgtcaaatccttgctttcctggagcagaatgcaacagctacccagatgggtct
tggtcatgtggggcatgcccagcaggataccttggcaatggtaccttctgcgaggatctt
gatgagtgtatagctgtgtcagatgtttgctttaaagtgaatcaggtccatcgctgtgtg
aacacaaatccgggtttccactgcttgccgtgtcctccacgctataaaggaagtcagccc
tatggagtagggcttgaagttgccaagacagagaagcaagtctgtgaacctgagaatccg
tgcaaggacaagacacacagctgccacaagtctgcagagtgcatctatctgggccatttc
agtgatccaatgtacaaatgtgaatgtagaacaggttatgctggtgatggacgcatctgt
ggtgaggattcagatttggatggctggcctaataataacttggtctgtgctgctaatgca
acgtaccactgtgtgaaggataactgcccccttctgcctaactctggccaagaagacttt
gacaaagatggcaaaggagatgcctgtgatgaggatgatgacaatgatggtgttgaagat
gacaaagacaattgccctcttctgttcaaccctcgccagtttgattatgacaaggatgaa
gttggtgaccgctgtgacaattgtccctatgtgcacaaccctgctcagattgacacagac
aacaatggggaaggagactcatgtgctgtggacattgatggagatgacatttttaatgaa
cgggataattgcccttacgtctacaacacagaccagagtgatacagatggtgatggagtt
ggtgatcagtgtgataattgtccattgatgcataatccagaccagactgatgcagataat
gaccttgttggtgaccagtgtgacaataatgaggacatagatgaagatggccaccagaac
aaccaggataactgcccttacatccccaacgctaaccaggctgaccacgatcaggatggt
aaaggagatgcctgtgatcctgatgatgacaatgatggtgtcccagatgacagggacaat
tgccgcctcagatacaaccctgagcaggaagactcagatggtgatgggagaggtgatatt
tgcaaagatgactttgacaatgacaatgttccagatatctatgatgtgtgccctgaaaac
aatgccattagtgaaactgatttcagaaagttccagatggtccctctggaccccaaggga
acggctcagattgatcccaactgggttattcgccaccaaggcaaggaactggtacagact
gctaactctgatcctggaatagctgtaggctacgatgagttcagctctgttgacttcagc
gggacattctatgttaacacagaccgcgatgatgactatgctggctttgtctttggctac
cagtccagcagtcggttttatgttctgatgtggaagcaggtcactcagacctattgggag
gacaaacccaccagggcttacggctattctggtgtgtcgctcaaagtagtgaattcaaca
acgggtactggtgagcacttaagaaatgctctctggcacacaggaaacacccctggacag
gtgcgtactttgtggcatgatcccaagaacattggctggaaagattatactgcttacagg
tggcacttaattcataggcctaaaacaggattaataaaagttctggtttatgaagggaaa
caagtcatggtggattctggaccaatctatgatacaacttttgctggtggacgattaggt
ctttttgtcttctctcaagagatggtctatttctctgacctcaaatatgaatgcagagat
gcttga

DBGET integrated database retrieval system