KEGG   Taeniopygia guttata (zebra finch): 100221323Help
Entry
100221323         CDS       T01082                                 

Gene name
EIF4E1B
Definition
eukaryotic translation initiation factor 4E family member 1B
Orthology
K03259  
translation initiation factor 4E
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100221323 (EIF4E1B)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100221323 (EIF4E1B)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100221323 (EIF4E1B)
Translation factors [BR:tgu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100221323 (EIF4E1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 210 aa AA seqDB search
MATGEQRQQERRRQRARQQELLPAEILGKHPLQNRWALWFFKNDKSKMWQANLRLVTKFS
TVEDFWALYSHIQLASKLTAGCDYSLFKDGIEPMWEDSQNKRGGRWLITLAKQQRHTELD
RFWLDTLLCLIGEMFDEYSDEVCGAVINIRAKGDKIAIWTREADNQEGVTHIGRVYKEHL
GLSQKVAIGYQAHADTATKSSSLAKTKFVM
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggctacgggggagcagaggcagcaggagcgacgccggcagagggctcggcagcaagag
ctgctcccagcagagatcctgggcaagcaccccctgcagaacagatgggcactctggttt
ttcaagaatgacaagagcaagatgtggcaggcaaacctgcgcctcgtcaccaaattcagc
actgtggaggacttctgggcgctgtacagtcacatccagctcgccagcaagctcacagct
ggctgtgactactccctcttcaaggatggcattgagcccatgtgggaggacagccagaac
aagcgtggcgggcgctggctcatcaccctggccaagcagcagcggcacaccgagctggac
cgcttctggctggacacactgctgtgcctcattggggagatgtttgatgagtacagcgac
gaggtgtgtggggccgtcatcaacatccgcgccaagggggacaagattgccatctggacc
cgggaggcggataaccaggaaggggtcacccacattgggcgtgtctacaaggagcacctg
gggttgtcacagaaggtggccattgggtaccaggctcatgcggatacggccaccaagagc
agctcccttgccaagaccaagtttgtgatgtga

DBGET integrated database retrieval system