KEGG   Taeniopygia guttata (zebra finch): 100221473Help
Entry
100221473         CDS       T01082                                 

Gene name
USP2
Definition
(RefSeq) ubiquitin specific peptidase 2
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100221473 (USP2)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100221473 (USP2)
Ubiquitin system [BR:tgu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100221473 (USP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
24
AA seq 394 aa AA seqDB search
MRDSYTVTLPEEPPALPDLHKDLRPRTSMPGSLLVSTFVGLVLNKTKSSKAVQGLTGLRN
LGNTCFMNSILQCLSNSKELRDYCLQNQYLRDLNNNSRMRTALMSEFAKLIQLLWTSSPN
ESVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHSEVNRVLVRPRASTDSLDHLP
DDEKSRQMWRRYQEREDSRISDLFVGQLKSSLTCSECGYCSTAFDPFWDLSLPIPKKGYG
EVTLMDCLRLFTKEDVLDGDEKPTCCRCKARTRCTKKFSIQKFPKILVLHLKRFSEARIR
SSKLTTFVNFPLKDLDLREFASQSCNHAVYNLYAVSNHSGTTMGGHYTAYCKSPVSSEWH
SFNDSRVTPMSSSHVRSSDAYLLFYELASPSSRM
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagggattcctacacggtgacgctgcccgaggagccccccgcgctccccgaccttcac
aaggacctgcggccccgcacctccatgccagggtccctgctggtctccaccttcgtcggg
ctcgtcctcaacaagaccaagagctccaaggccgtgcaggggctgaccggtctgcggaac
ctcggcaacacgtgcttcatgaactccatcctgcagtgcctgagcaacagcaaggagctg
cgggattactgcctgcagaaccagtacctgcgggacctcaacaacaacagccgcatgcgc
accgcgctcatgtcagagtttgcaaagctgattcagctgctctggacctcgtcccccaac
gagagcgtgagcccgtccgagttcaagacgcagatccagagatacgccccgcgcttcgtc
ggctacaaccagcaggatgcacaggagttcctgcggttcctgctggacgggctgcacagc
gaggtgaaccgagtgctggtgcggccccgggccagcaccgacagcctggatcacctccct
gacgacgagaagagccggcagatgtggaggaggtaccaggagagggaggacagccgcatc
agcgacctctttgttgggcagctgaagagctctctgacctgcagcgagtgtggctactgc
tccacagccttcgaccccttctgggacctgtccctgcccatccccaagaaaggctacggg
gaggtgacgctcatggattgcctccggctcttcaccaaagaggatgtgctggatggggac
gagaaaccgacgtgttgtcgctgcaaagccaggacaaggtgcacaaaaaaattcagcatc
cagaagttccccaagatcctggtgcttcacctgaagcgcttttctgaggccaggatacga
agcagcaaactcaccaccttcgtcaacttcccgctgaaggacctggacctccgggaattc
gcctcgcagagctgcaaccacgccgtttacaacctctacgccgtctccaaccactcgggc
accaccatggggggacactacacggcctactgcaagagccccgtgtccagcgagtggcac
agcttcaacgactcccgcgtcacccccatgtcctcgagccacgtgcgcagcagcgatgcc
tacctgctcttctacgagctggccagcccgtcctcccgcatgtag

DBGET integrated database retrieval system