KEGG   Taeniopygia guttata (zebra finch): 100221531Help
Entry
100221531         CDS       T01082                                 

Gene name
USP7
Definition
ubiquitin specific peptidase 7 (herpes virus-associated)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
FoxO signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100221531 (USP7)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100221531 (USP7)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100221531 (USP7)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100221531 (USP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 1103 aa AA seqDB search
MNHHQQQQQHQKPGEQQLSEPEDMEMEAGDTDDPPRITQNPVINGNVAMADGHNNTEEDM
EDDTSWRSEATFQFTVERFNRLSESVLSPPCFVRNLPWKIMVMPRLYPDRPHQKSVGFFL
QCNAESDSTSWSCHAQAVLKIINYKDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDP
EKGFIEEDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLR
KAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQEL
CRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKN
IFESFIDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNI
KINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCK
FDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQPVTDHDIPQQ
LVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKN
STLTEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWT
IFLETVDPEMAATGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPV
MCERAGFPQETNLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSE
LPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQF
FKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWL
NSQFREEEITVYPDKHGCVRDLLEECKKVVELSEKGSGKLRLLEIVSYKIIGVHQEDELL
ECLSPATSRTFRIEEIPLDQVDIDKENEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFRE
VMKRIQTMLDIQEKEFEKFKFAIVMMGRHQYLNEDEYEVNLKDFESQPGNMSHPRPWLGL
DHFNKAPKRSRYTYLEKAIKIHN
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccatcagcagcagcagcagcaccagaagcccggggagcagcagctgagcgag
cccgaggacatggagatggaagctggagatacagatgatcctccaagaattactcaaaat
cctgtaattaatgggaatgtagcgatggctgacggacataacaacactgaggaggacatg
gaagatgatacaagttggcgatcagaagcaacatttcagtttacagtggaacgcttcaac
aggttgagtgagtcagtgctcagccctccctgcttcgttcggaatttgccatggaagatc
atggtaatgccacgactctacccggacagaccacaccaaaaaagtgtaggattcttcctt
cagtgcaatgctgaatcggattccacgtcatggtcctgtcatgcacaagcagttctcaag
ataataaactacaaggatgatgaaaaatcattcagtcgtcgtattagtcacttgttcttt
cataaggagaatgactggggcttttctaacttcatggcctggagtgaagttactgatccc
gaaaaaggctttatagaagaggacaaagtcacttttgaagtctatgttcaggcagatgct
ccacacggagtagcgtgggattcaaagaagcacacaggctatgttggcttaaagaaccag
ggagcaacttgttacatgaacagtttgttacagactttatttttcacaaatcagctacga
aaggctgtttacatgatgcccacagaaggagatgattcatccaaaagtgttcctttagca
ttgcaaagagtgttttatgagctgcaacatagtgacaagccagttggaactaaaaagtta
acaaaatcatttgggtgggaaactttggacagcttcatgcaacatgatgtccaggaatta
tgtcgagtgctgcttgataatgtggaaaataaaatgaaaggcacatgtgtagaaggcact
attcctaagttgttcagagggaagatggtgtcttatatccagtgcaagcacgtagactac
cgatctgaacgaatagaagattattatgacatccagctaagtataaagggaaagaaaaat
atttttgagtccttcattgactacgttgcagtggagcagttggatggtgataacaagtat
gatgcaggagaacatggcttgcaggaggcagagaaaggggtgaagttcctaacactgcca
ccagtattacacctacagctcatgaggtttatgtatgatcctcagactgaccaaaacatc
aagataaatgataggtttgaatttcctgaacagttgccattagatgaatttttgcaaaaa
acagatcctaaagatcctgcaaattacattctccatgcagttctagtacacagtggagat
aaccatggtggacattatgttgtttacttaaatccaaagggcgatggcaaatggtgtaaa
ttcgatgacgacgttgtgtcgaggtgcaccaaggaggaggcgatcgagcacaactacggc
gggcacgacgacgacctgtccgtgcggcactgcaccaacgcctacatgctggtctacatc
agggagtccaagctcagtgaagttctgcagcctgtcactgaccatgatattcctcaacaa
cttgtagaaaggctacaagaagagaaaaggatagaagctcagaagaggaaggagaggcag
gaagctcacctctatatgcaagtgcagatagtggcagaggatcagttctgtggtcaccaa
ggcaatgatatgtatgatgaagaaaaagtgaaatacactgttttcaaagtattaaaaaac
tccacacttacagaatttgttcaaaacctctctcaaacaatgggatttccccaggatcaa
atcagattatggccaatgcaagctagaagtaatggaacaaaaagacctgcaatgttagat
aatgaagcagatggcaataaaacgatgattgagctcagtgacaatgagaatccatggaca
atatttttggaaacagtagatccagagatggctgctactggagcaacattacccaaattt
gataaagatcatgatgtaatgttgtttctgaagatgtatgatccgaaaactcggagtttg
aattattgtggacatatctacacccctatatcctgtaaaatacgtgacttgcttccagtt
atgtgtgagagagcaggatttccacaagaaactaaccttatcctctatgaggaagttaaa
ccaaatttaacagaaaggattcaagactatgatgtatctcttgataaagctcttgatgaa
ctcatggatggtgacatcatagtgtttcaaaaggatgacccagaaaatgataacagtgag
ctcccgacagctaaggaatacttccgagacctctatcaccgtgtggatgtaattttctgt
gataaaaccatcccaaatgacccaggctttgttgttactttatccaataggatgaattac
tttcaggttgcaaagacagttgctcagagacttaacacggatccaatgctattacaattt
ttcaagtcccaaggttatagggatggccctggtaatcctcttagacataattatgaaggt
actctaagagatcttctgcagttcttcaagcctaggcaaccaaaaaaactctactatcaa
cagctcaaaatgaagataactgattttgaaaacagaagaagttttaaatgcatatggcta
aatagccagtttagggaagaggaaataacagtatatccagataagcatgggtgtgtgcgg
gacctgttagaagaatgtaaaaaagttgtagaactctctgaaaaaggttcagggaaatta
aggctgctagaaattgtaagttacaaaatcatcggtgtccatcaggaggatgagctgtta
gagtgtttgtcacctgcaacaagtcgaacgtttcgaatagaggaaattcctctggaccag
gtagatatagataaagagaatgagatgctaatcacagtggcacatttccacaaagaggtt
ttcgggacatttggaattccattcttgctgaggatacaccagggtgaacacttcagagag
gttatgaagcggattcagacaatgctggacatacaagaaaaagaatttgaaaagtttaaa
tttgccattgtaatgatgggccgacaccagtatctcaacgaagatgagtatgaagtgaac
ttgaaagattttgagtcccaacctggcaacatgtctcatccaaggccatggctagggctt
gaccatttcaataaagccccaaagagaagtcgctacacttaccttgaaaaagctattaaa
atccataactga

DBGET integrated database retrieval system