KEGG   Taeniopygia guttata (zebra finch): 100221709Help
Entry
100221709         CDS       T01082                                 

Gene name
KAT2A
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100221709 (KAT2A)
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100221709 (KAT2A)
Transcription machinery [BR:tgu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100221709 (KAT2A)
Chromosome [BR:tgu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100221709 (KAT2A)
   HAT complexes
    PCAF complex
     100221709 (KAT2A)
    STAGA complex
     100221709 (KAT2A)
    TFTC complex
     100221709 (KAT2A)
    SAGA complex
     100221709 (KAT2A)
    SLIK complex
     100221709 (KAT2A)
    ADA-HAT complex
     100221709 (KAT2A)
    HAT-A2 complex
     100221709 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
27
AA seq 788 aa AA seqDB search
MCSTENPRQVLSIPPGSFRTVASHLWDAAGTLPRGARVPPASAGTSRAPPAAPRSSGANP
RPRGAGGRSRCRGTDREARPRSTPAAWPHPAPLREGGGRCANDACKCNGWKNPNPPTAPR
MDLQQPVTNLSEPCRSCGHALADHVSHLENVSEEEINRLLGMVVDVENLFMSVHKEEDTD
TKQVYFYLFKLLRKCILQMSQPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLPPKERQT
MYELSKMFLLCLNYWKLETPSQFRQRSQNDDVATYKVNYTRWLCYCHVPQSCDSLPRYET
THVFGRSLLKSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGENSP
IWEADFTVPAAEGAQLVSRPAAVSTVAVPTTPLFSKKLSSSSSATSLDTSTPEPLPGEKR
KLPESLTLEDAKRIRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEE
RRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALI
KDGRVIGGICFRMFPTQGFTEIVFCTVTSNEQAKETGFSKDIKVPKSRYLGYIKDYEGAT
LMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLTCFKEGVRQIPIESVP
GIRETGWKPLGKEKGKELKDPDQLYNMLKNLLAQIKTHPSAWPFMEPVKKSEAPDYYEII
RFPIDLKTMTERLKNRYYVTKKLFIADLQRIITNCREYNPPDSDYCKCANTLEKFFYFKL
KEGGLIDK
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagcactgagaatccccggcaggtcctgagcatccccccgggcagctttcggaca
gttgcctcccatctttgggatgctgctggaaccctcccgcgcggtgcccgcgtccccccc
gccagcgctggcacctcccgggcgccgcccgccgctccgcgcagcagcggcgctaatccg
cgtccccgcggtgccggcgggcggagccggtgccgcggtaccgaccgggaggcgcggcca
cgctccacgcccgccgcttggccgcaccccgcgccgctgcgagaaggcggaggacggtgc
gccaacgacgcctgcaagtgcaatggctggaagaaccccaacccccccacagcccctcga
atggacctgcagcagccggtgaccaacctgagcgagccgtgccggagctgcggccacgcg
ctggcggaccacgtgtcccacctggagaacgtctcagaggaggagatcaaccgtctgctg
ggcatggtggtggatgtggagaacctcttcatgtcagtgcacaaggaggaggacacggac
accaagcaggtgtatttctacctgttcaagctgctgcggaagtgcatcctgcagatgagc
cagcctgtggtcgaggggtccctggggagccctccctttgagaaaccaaacattgagcag
ggagtcctgaattttgtgcagtacaagttcagccacttgccgcccaaggagcgccagacc
atgtatgagctctccaagatgttcctgctgtgcctcaactactggaagctggagacaccg
tcccagttccgtcagcgctcccagaatgacgatgtggccacctacaaggtcaactacacc
aggtggctgtgctactgccatgtgccacagagctgtgacagcctgccccgctatgagacc
acccacgtcttcgggcgcagcctcctcaagtccatcttcacggtgacccgccggcagctg
ctggagaaattccgggtggagaaggacaagctggtgccggagaagcggacactgatcctc
acccacttccccaagttcctctccatgctggaggaggagatctacggtgagaactctcca
atctgggaggctgatttcacagtgccagctgcggagggtgcccagctggtgtctcgccca
gctgcagtcagcaccgttgccgttcccaccactcctctcttcagcaagaagctcagcagc
agcagctcggccaccagcctggacaccagcaccccagagcccctgccaggagagaaacgg
aagctacctgagagcctgacgctggaggatgccaagcggatccgtgtcatgggagacatc
cccatggagctggtgaacgaggtcatgctgaccatcaccgaccccgctgccatgctgggc
cccgagaccagcctgctgtcggccaacgcggcgcgggacgagacggcgcggctggaggag
cgccgcggcatcatcgagttccacgtcatcggcaactcgctctcgcagaaatccaacaag
aagatcctgatgtggctggtggggctgcagaacgtcttctcgcaccagctgccccgcatg
cccaaggagtacatcactcgcctcgtctttgacccgaagcacaagaccctggcactgatc
aaggatggacgggtgatcgggggcatctgcttccgcatgttccctacccaaggcttcacg
gagattgtcttctgcactgtcacctccaatgagcaagcgaaggagacaggcttttccaag
gacatcaaggtccccaagagccgctacctgggatacatcaaggactacgagggggcgacc
ctgatggagtgtgagctgaacccccgcatcccctacaccgagctttcacacatcatcaag
aagcagaaggagatcatcaagaagctgatcgagaggaaacaggcgcagatccgcaaagtc
tacccaggcctgacctgcttcaaggagggtgtgcggcagatccccatcgagagcgtccct
ggcatccgagaaacaggatggaaaccgctggggaaggagaaggggaaggagctgaaggac
ccagaccagctgtataacatgctgaagaaccttctggcccagatcaagacccaccccagt
gcgtggcccttcatggagccggtgaagaagtcagaggcaccagactactatgaaatcatc
cgcttccccattgacctgaagaccatgacggagcggctgaagaaccgctactacgtcacc
aagaagcttttcatcgccgacctgcagcgcatcatcaccaactgccgcgagtacaacccg
cccgacagcgactactgcaagtgtgccaacaccctcgagaagttcttctacttcaagctc
aaggagggggggctcatcgacaagtag

DBGET integrated database retrieval system