KEGG   Taeniopygia guttata (zebra finch): 100221709Help
Entry
100221709         CDS       T01082                                 

Gene name
KAT2A
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100221709 (KAT2A)
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100221709 (KAT2A)
Transcription machinery [BR:tgu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100221709 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
27
AA seq 788 aa AA seqDB search
MCSTENPRQVLSIPPGSFRTVASHLWDAAGTLPRGARVPPASAGTSRAPPAAPRSSGANP
RPRGAGGRSRCRGTDREARPRSTPAAWPHPAPLREGGGRCANDACKCNGWKNPNPPTAPR
MDLQQPVTNLSEPCRSCGHALADHVSHLENVSEEEINRLLGMVVDVENLFMSVHKEEDTD
TKQVYFYLFKLLRKCILQMSQPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLPPKERQT
MYELSKMFLLCLNYWKLETPSQFRQRSQNDDVATYKVNYTRWLCYCHVPQSCDSLPRYET
THVFGRSLLKSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGENSP
IWEADFTVPAAEGAQLVSRPAAVSTVAVPTTPLFSKKLSSSSSATSLDTSTPEPLPGEKR
KLPESLTLEDAKRIRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEE
RRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALI
KDGRVIGGICFRMFPTQGFTEIVFCTVTSNEQAKETGFSKDIKVPKSRYLGYIKDYEGAT
LMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLTCFKEGVRQIPIESVP
GIRETGWKPLGKEKGKELKDPDQLYNMLKNLLAQIKTHPSAWPFMEPVKKSEAPDYYEII
RFPIDLKTMTERLKNRYYVTKKLFIADLQRIITNCREYNPPDSDYCKCANTLEKFFYFKL
KEGGLIDK
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagcactgagaatccccggcaggtcctgagcatccccccgggcagctttcggaca
gttgcctcccatctttgggatgctgctggaaccctcccgcgcggtgcccgcgtccccccc
gccagcgctggcacctcccgggcgccgcccgccgctccgcgcagcagcggcgctaatccg
cgtccccgcggtgccggcgggcggagccggtgccgcggtaccgaccgggaggcgcggcca
cgctccacgcccgccgcttggccgcaccccgcgccgctgcgagaaggcggaggacggtgc
gccaacgacgcctgcaagtgcaatggctggaagaaccccaacccccccacagcccctcga
atggacctgcagcagccggtgaccaacctgagcgagccgtgccggagctgcggccacgcg
ctggcggaccacgtgtcccacctggagaacgtctcagaggaggagatcaaccgtctgctg
ggcatggtggtggatgtggagaacctcttcatgtcagtgcacaaggaggaggacacggac
accaagcaggtgtatttctacctgttcaagctgctgcggaagtgcatcctgcagatgagc
cagcctgtggtcgaggggtccctggggagccctccctttgagaaaccaaacattgagcag
ggagtcctgaattttgtgcagtacaagttcagccacttgccgcccaaggagcgccagacc
atgtatgagctctccaagatgttcctgctgtgcctcaactactggaagctggagacaccg
tcccagttccgtcagcgctcccagaatgacgatgtggccacctacaaggtcaactacacc
aggtggctgtgctactgccatgtgccacagagctgtgacagcctgccccgctatgagacc
acccacgtcttcgggcgcagcctcctcaagtccatcttcacggtgacccgccggcagctg
ctggagaaattccgggtggagaaggacaagctggtgccggagaagcggacactgatcctc
acccacttccccaagttcctctccatgctggaggaggagatctacggtgagaactctcca
atctgggaggctgatttcacagtgccagctgcggagggtgcccagctggtgtctcgccca
gctgcagtcagcaccgttgccgttcccaccactcctctcttcagcaagaagctcagcagc
agcagctcggccaccagcctggacaccagcaccccagagcccctgccaggagagaaacgg
aagctacctgagagcctgacgctggaggatgccaagcggatccgtgtcatgggagacatc
cccatggagctggtgaacgaggtcatgctgaccatcaccgaccccgctgccatgctgggc
cccgagaccagcctgctgtcggccaacgcggcgcgggacgagacggcgcggctggaggag
cgccgcggcatcatcgagttccacgtcatcggcaactcgctctcgcagaaatccaacaag
aagatcctgatgtggctggtggggctgcagaacgtcttctcgcaccagctgccccgcatg
cccaaggagtacatcactcgcctcgtctttgacccgaagcacaagaccctggcactgatc
aaggatggacgggtgatcgggggcatctgcttccgcatgttccctacccaaggcttcacg
gagattgtcttctgcactgtcacctccaatgagcaagcgaaggagacaggcttttccaag
gacatcaaggtccccaagagccgctacctgggatacatcaaggactacgagggggcgacc
ctgatggagtgtgagctgaacccccgcatcccctacaccgagctttcacacatcatcaag
aagcagaaggagatcatcaagaagctgatcgagaggaaacaggcgcagatccgcaaagtc
tacccaggcctgacctgcttcaaggagggtgtgcggcagatccccatcgagagcgtccct
ggcatccgagaaacaggatggaaaccgctggggaaggagaaggggaaggagctgaaggac
ccagaccagctgtataacatgctgaagaaccttctggcccagatcaagacccaccccagt
gcgtggcccttcatggagccggtgaagaagtcagaggcaccagactactatgaaatcatc
cgcttccccattgacctgaagaccatgacggagcggctgaagaaccgctactacgtcacc
aagaagcttttcatcgccgacctgcagcgcatcatcaccaactgccgcgagtacaacccg
cccgacagcgactactgcaagtgtgccaacaccctcgagaagttcttctacttcaagctc
aaggagggggggctcatcgacaagtag

DBGET integrated database retrieval system