KEGG   Taeniopygia guttata (zebra finch): 100221749Help
Entry
100221749         CDS       T01082                                 

Gene name
LYPLA2
Definition
lysophospholipase II
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100221749 (LYPLA2)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100221749 (LYPLA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
23
AA seq 232 aa AA seqDB search
MCGNNMSVPLLADAVTVSGAERETAAVIFLHGLGDTGHSWADALSSIRLPYVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLTPDAPEDEAGIKKAAENIKAIIEHEMKNGIPPNRIILGG
FSQGGALSLYTALTCQHQLAGIVALSCWLPLHKAFPQAANNSVNKDIAILQCHGEMDPMI
PVRFGALTAEKLKSVVTPAKVQFKTYPGVMHSSCPQEMMAVKEFIEKLLPRI
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtaacaacatgtctgtccccctcctcgccgacgctgtcaccgtgtcaggggca
gagcgggagaccgctgcggtcattttcctccatggccttggagacacggggcacagctgg
gccgatgctctctcctccatccgcctcccctacgtgaagtacatctgccctcacgcgccc
cggatcccagtgaccctcaacatgaagatggtcatgccctcctggttcgacctgatggga
ctgactccggatgcacccgaggatgaagctgggatcaagaaagctgcagaaaacattaaa
gcaatcattgagcacgagatgaagaacgggatcccccccaaccgcatcatcctggggggc
ttctcacagggcggtgccttgtcgctgtacacggctctcacctgccagcaccagctggcc
gggatcgtggcgctcagctgctggctcccgctgcacaaagccttcccacaggcggcgaac
aacagcgtgaacaaggacatcgccatcctgcagtgccacggggagatggaccccatgatc
cccgtgcgcttcggggccctcacggccgagaagctcaagtctgtcgtcacccccgccaag
gtgcagttcaaaacctaccccggcgtgatgcacagttcctgtcctcaggagatgatggcg
gtgaaggagttcatcgagaagctgctgccccggatctga

DBGET integrated database retrieval system