KEGG   Taeniopygia guttata (zebra finch): 100221838Help
Entry
100221838         CDS       T01082                                 

Definition
chymotrypsinogen 2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     100221838
Peptidases [BR:tgu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100221838
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 265 aa AA seqDB search
MALLWVLSCLALVGFAHCGVPAIPPVVRGYNRIVNGEAVVPGSWPWQVSLQRNYGFHFCG
GXLISENWVVHRCPLRVRKTDSVVVGAYDQDAPGPDQQELKIEKVFKNPRFNMLTIHDDI
TLIKLATPAQLSDRVSPVCLPAATDEFPGGMTCVTTGWGLTDSSASDTPAVLQQAAVPLL
TNAQCKEFWGFRIRDVMVCAGADGASSCMGDSGGPLVCQRDGAWNLVGIVSWGSNTCDTK
TPGVYARVTKLRGWIDSILEANGGL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctgtgggtgttgagctgcctggcactggtgggctttgcccactgcggcgtg
cccgccatcccgcccgtcgtccgtggctacaaccgcatcgtcaacggggaggcggtggtg
ccagggtcctggccatggcaggtgtccctccagcgcaactacggcttccacttctgcggc
ggtnccctgatcagcgagaactgggtggtccatcgctgcccactgcgcgtcaggaaaacc
gacagcgtggtggtgggcgcctacgaccaggacgcacccgggcctgatcagcaggaactg
aaaatcgagaaggtcttcaagaaccccaggttcaacatgctgaccatccacgacgacatc
accctgatcaaactggccactccagcgcagctgtcggatcgcgtgtctcccgtctgcctg
cccgcggccactgacgaattcccagggggaatgacctgcgtcaccactggctgggggctc
actgactccagtgcctcggacacgccggcggtgctgcagcaggcggctgtgcccctgctc
accaacgcccagtgcaaggagttctggggcttccgcatccgcgacgtgatggtgtgtgcc
ggcgccgacggagcctcgtcctgcatgggcgactccgggggcccgctggtgtgccagagg
gacggcgcctggaacctggtgggcatcgtctcctggggcagcaacacctgcgacaccaag
acgcccggcgtgtacgcccgcgtcaccaagctccgcggctggatcgactccatcctcgag
gccaacggaggcctgtaa

DBGET integrated database retrieval system