KEGG   Taeniopygia guttata (zebra finch): 100221838Help
Entry
100221838         CDS       T01082                                 

Gene name
CTRB1
Definition
(RefSeq) chymotrypsinogen B1
  KO
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     100221838 (CTRB1)
Peptidases [BR:tgu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100221838 (CTRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 271 aa AA seqDB search
MALLWVLSCLALVGFARAALPENCGVPAIPPVVRGYNRIVNGEAVVPGSWPWQVSLQRNY
GFHFCGGXLISENWVVHRCPLRVRKTDSVVVGAYDQDAPGPDQQELKIEKVFKNPRFNML
TIHDDITLIKLATPAQLSDRVSPVCLPAATDEFPGGMTCVTTGWGLTDSSASDTPAVLQQ
AAVPLLTNAQCKEFWGFRIRDVMVCAGADGASSCMGDSGGPLVCQRDGAWNLVGIVSWGS
NTCDTKTPGVYARVTKLRGWIDSILEANGGL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctgtgggtgttgagctgcctggcactggtgggctttgcccgtgccgccctc
cctgagaactgcggcgtgcccgccatcccgcccgtcgtccgtggctacaaccgcatcgtc
aacggggaggcggtggtgccagggtcctggccatggcaggtgtccctccagcgcaactac
ggcttccacttctgcggcggtnccctgatcagcgagaactgggtggtccatcgctgccca
ctgcgcgtcaggaaaaccgacagcgtggtggtgggcgcctacgaccaggacgcacccggg
cctgatcagcaggaactgaaaatcgagaaggtcttcaagaaccccaggttcaacatgctg
accatccacgacgacatcaccctgatcaaactggccactccagcgcagctgtcggatcgc
gtgtctcccgtctgcctgcccgcggccactgacgaattcccagggggaatgacctgcgtc
accactggctgggggctcactgactccagtgcctcggacacgccggcggtgctgcagcag
gcggctgtgcccctgctcaccaacgcccagtgcaaggagttctggggcttccgcatccgc
gacgtgatggtgtgtgccggcgccgacggagcctcgtcctgcatgggcgactccgggggc
ccgctggtgtgccagagggacggcgcctggaacctggtgggcatcgtctcctggggcagc
aacacctgcgacaccaagacgcccggcgtgtacgcccgcgtcaccaagctccgcggctgg
atcgactccatcctcgaggccaacggaggcctgtaa

DBGET integrated database retrieval system