KEGG   Taeniopygia guttata (zebra finch): 100221959Help
Entry
100221959         CDS       T01082                                 

Gene name
PLCB4
Definition
phospholipase C, beta 4
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
GnRH signaling pathway
Melanogenesis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100221959 (PLCB4)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100221959 (PLCB4)
   04020 Calcium signaling pathway
    100221959 (PLCB4)
   04070 Phosphatidylinositol signaling system
    100221959 (PLCB4)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100221959 (PLCB4)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    100221959 (PLCB4)
   04916 Melanogenesis
    100221959 (PLCB4)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100221959 (PLCB4)
   04270 Vascular smooth muscle contraction
    100221959 (PLCB4)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100221959 (PLCB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 1194 aa AA seqDB search
MAKPYEFNWQKPVPSFMQDGAVFDRYEEESFVFESNCLFQVDEFGFFLSWKSEGKEGQVL
ECSLINSVRFGAVPKDPKILTALEAVGKSENELEGRIVCVCSGTDLVNISFTFMVAENTE
IAKQWVEGLGSIIHNFRANNVSPMTCLKKHWMKLAFLTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDTKRAMQIIETYEPDEDLKRKGVISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQPLETHPLEQGKALPSPNDLKRKILIKNKRLKPEVEKKQLDALKKM
MEAGETSAPVNILEDDNEEEIENADQEEEAHPEYKFGSDLTVDDYSQKEAVAISVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMVNYAQPVKFQGFDVAEERNIHHNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPNDTSKNDKKGKANNPKANVTPQSSSELRPSTTAG
FGSGTDAKKGIDLIPQVKIEDLKQMKAYIKHLKKQQKELNALKKKHAKEHSAMQKLHCTQ
IDKIVAQYDKEKVSYEKMLEKAIKKKGGSNCVELKKETEIKIQTLTSDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLNQQCELLKKLLINAHEQQTQQLKFSHDRESKEMRANQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEVLEKQNEQLLKSCHAVSQTQGKGDAADGEAGSRDGSQASNSGLKPQQAN
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccttatgaatttaactggcagaagccagttccctcttttatgcaagatgga
gctgtgtttgatagatatgaagaggaatcttttgtctttgaaagcaactgtctcttccaa
gtggacgaatttggtttttttctgagctggaaaagtgaaggaaaggagggacaggtatta
gaatgctccctgatcaacagtgttcgttttggagctgtaccaaaggatcccaaaatacta
actgcactcgaggctgttggaaaatcagaaaatgagttggaaggacggatagtgtgtgtt
tgcagtggcacagatctggtgaacatcagcttcactttcatggtagcagaaaacacagaa
atagccaagcaatgggtagaagggcttggatccatcatacataactttagagctaacaat
gtcagtccaatgacgtgtctcaagaaacactggatgaagctggcctttctaacaaacaca
aatgggaaaattccagttcggagcataaccagaacctttgcatcaggtaaaacagaaaaa
gtgatctttcaggcactgaaggaattgggtcttcccagtggaaagaatgatgaaattgag
cctgcagcttttacttatgagaaattttatgagcttacccaaaagatatgtcccagaact
gacatagaggacctctttaagaagatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcggctcaatgaaattttattt
cccttttatgacacaaaaagagcaatgcagataattgagacatatgagccagatgaagac
ttgaagaggaaaggtgtcatatccagtgatgggttttgcagatacttgatgtcagatgaa
aatgcccctgttttcttagaccgtttggaattgtatcaagagatggaccatcctctggct
cattacttcatcagctcctctcacaatacctatttaacaggcaggcagtttgggggcaag
tcttcagtggagatgtacagacaagtgcttttggctggatgcaggtgtgtcgagctggac
tgttgggatggcaaaggtgaagaccaagaaccaataataacccatggaaaagcaatgtgc
acagacatccttttcaaggatgtaattcaagccattaaggaaacagcatttgttacgtca
gagtaccctgtcattctttcatttgagaatcactgcagcaaatatcaacagtacaagatg
tcaaaatactgtgaagatctttttggagatctcctgttgaagcagcctctagaaacacat
ccacttgaacaaggtaaagccttaccatctcctaatgacctcaaaagaaagattctcata
aagaataaaaggctgaaacctgaagtagaaaagaaacagcttgatgctctgaaaaagatg
atggaggctggggaaacttctgctcctgtaaacatcctggaggatgataatgaagaggaa
atagaaaacgctgaccaggaagaggaagctcatcctgagtataaatttggaagtgacctt
actgtagatgattacagtcaaaaagaagctgttgccatcagtgtcaaaaagggtttagta
actgtggaagatgaacaagcatggatggcatcttacaaatatgtaggtgccacaaccaat
atacatccatatttatcaacaatggtcaactatgctcaacctgtaaaatttcaaggtttc
gatgtagcagaagaacgtaacattcaccataacatgtcctctttcaacgaatcagtcgga
ctagggtatttgaagactcatgccattgagtttgtgaattacaataagcgacaaatgagt
cggatatacccaaagggaggccgtgtggattccagtaattacatgcctcaaattttctgg
aacgctggctgccagatggtctcactgaactatcagaccccagatttagcaatgcagttg
aatcaaggaaaatttgagtacaatggatcgtgcgggtatctactaaagccagatttcatg
cgacgaccagacaggacatttgacccgttctctgaaactcctgtagatggtgttattgct
gcaacatgttctgtacaggtgatatctgggcagttcttgtcagacaagaagattgggacc
tacgtggaggtggacatgtacgggctgcccacggacacgattcgcaaggagttccgcacg
cgcatggtgatgaacaacggcctgaaccctgtgtacaacgaggagtcctttgtcttcagg
aaggttatcctccctgaccttgctgtcctgagaatagcagtgtatgatgacaataataag
ctgattggtcagaggatcctgcctctggatgggctgcaagcaggttacagacacatttcc
ctccggaacgagggcaacaaacccctttctcttccaacggttttctgcaacattgtgctt
aaaacttatgtgcctgatgggtttggagatattgtggatgctttatcagatccaaagaaa
tttttatctatcacagaaaaaagagcagaccaaatgagagctatgggtattgaaactagt
gatatagctgatgtaccaaatgacacttcaaagaatgacaagaaaggaaaagccaataat
cccaaagccaatgtaacacctcagagcagttctgagcttcgacccagcaccaccgcaggc
tttggctctggcactgatgctaagaaaggtatagaccttattcctcaagtgaagatagaa
gatttaaagcaaatgaaggcttatataaagcatttaaagaaacagcagaaagagctgaat
gccttaaagaagaaacatgccaaggagcacagtgccatgcagaagttgcactgcacacag
attgacaaaatagtggcccaatatgataaagaaaaggtgtcatatgagaaaatgttggag
aaggcaatcaagaagaagggaggaagtaattgcgttgaattgaagaaagaaacggaaatt
aaaattcagacactaacatcagatcacaaatctaaggtcaaagagattgtggctcagcac
accaaagagtggtccgagatgatcaatacacacagcgctgaggagcaagaaatccgtgac
ttacacttgaaccaacagtgtgaactactgaagaaactgctcattaatgctcacgaacaa
caaacccagcagctgaaattctcccatgacagggaaagcaaggagatgcgtgccaaccag
gctaaaatatctatggagaacagcaaagccattagccaagacaaatctatcaaaaacaaa
gccgaaagggagaggcgagtcagagaactgaacagcagcaacacaaaaaagttcctggaa
gagagaaaaaggctggcaatgaaacagtcaaaggaaatggatcagttgaaaaaagttcaa
cttgagcacttagaagtcttggagaagcagaatgagcagcttttgaaatcctgtcatgca
gtgtctcaaacacaaggcaaaggagatgcagcagatggtgaagctggaagcagagatgga
tcgcaggccagcaacagtggtttaaagcctcaacaagcaaattga

DBGET integrated database retrieval system