KEGG   Taeniopygia guttata (zebra finch): 100221964Help
Entry
100221964         CDS       T01082                                 

Gene name
BPNT1
Definition
3'(2'), 5'-bisphosphate nucleotidase 1
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100221964 (BPNT1)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100221964 (BPNT1)
Transfer RNA biogenesis [BR:tgu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100221964 (BPNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 307 aa AA seqDB search
MASPALLMRVVASAYSVAEKAATIVRNVMSAGDLGIVEKAGPNDLQTKADRLVQMSICAS
LARKFPKVTIIGEEELPADDVTEDLIEDGHCEEILKKPCPAQYTGIKEEELVIWVDPLDG
TKEYTEGLLDHVTVLIGIAYGGKAIAGVINQPYYNYEAGANAVLGRTIWGVLGMGAFGFQ
LTEAPAGKHIVVTTRSHSSALVNECITALNPDQVIRVGGAGNKIIQLIEGKASAYVFASP
GCKKWDTCAPEAILHAVGGKITDIRGNSFQYNKEVKHMNSAGVLATLRNYDYYASRIPNT
VKESLVP
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcttctccagctctccttatgcgtgtagtagcctcagcatattctgttgcagaaaaa
gctgcaacaattgttagaaatgtgatgtctgcaggagatctgggcatagtggagaaggct
ggacccaatgacttgcagaccaaagctgaccgactggtacaaatgagcatttgtgcttcc
ctggcacggaagtttcccaaggtgacaatcataggagaagaagagctgcccgctgatgat
gtaactgaagatttaattgaagatggtcactgtgaagaaatactgaagaaaccttgtcct
gctcagtacacaggaattaaagaggaagagcttgtaatatgggttgatcccttggatgga
accaaggagtacactgaaggtctccttgaccatgtaacagttcttattggaattgcctat
ggaggcaaagcaatagcaggagttattaaccagccttattacaactatgaggcaggagct
aatgctgtgctgggcaggacaatctggggagtgctgggcatgggtgcctttggcttccag
ctgacagaagcccctgctggcaaacacatcgtggttaccacccgctcccacagcagcgcc
ctggtgaacgagtgcatcactgccttgaacccagaccaggtcatcagagttggaggagca
ggaaacaagatcattcaactcatagaaggcaaagcatctgcttatgtatttgccagtcct
gggtgcaagaagtgggatacatgtgcacctgaagctatcctacatgctgtgggaggcaag
ataactgatatccgtggaaattcatttcagtataacaaggaggtgaagcacatgaattca
gctggggtccttgccactttgagaaattatgactactatgccagtcgtattccaaacact
gtgaaagaatctcttgtgccttaa

DBGET integrated database retrieval system