KEGG   Taeniopygia guttata (zebra finch): 100221973Help
Entry
100221973         CDS       T01082                                 

Gene name
AURKA
Definition
aurora kinase A
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Oocyte meiosis
Class
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:tgu04114]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 319 aa AA seqDB search
MKENHAACPRPRRQAQNPEAESTSKQKTEETKKKSEETKKRQWSLDDFEIGRPLGKGKFG
NVYLAREKQSKFILALKVLFKTQLEEAGVEHQLRREVEIQSHLRHPNILRLYGYFHDVTR
VYLILEHAPRGEVYRELQRLSKFDEQRTATYITELADALSYCHSKRVIHRDIKPENLLLG
SNGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRTHDEKVDIWSLGVLCYEFLVG
KPPFETETYQETYRAISRVEFKFPPFVTEGARDLISRLLKHNPFHRLPLKDVLLHPWITA
NSTKIPTSRKSDAAAPSKT
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagaaccacgccgcctgcccccggccgcgccgccaagcacaaaatcctgaagca
gaaagcacctctaaacagaaaactgaagagaccaagaagaaaagtgaagagactaaaaaa
aggcaatggtcccttgatgattttgaaattggtcgtcctctggggaaaggaaaatttggg
aatgtgtacctggcacgtgaaaaacagagcaaatttattcttgcactgaaagtgctcttt
aaaacacagcttgaggaagctggtgtagagcatcaactacgaagagaagtggaaatacag
tctcatcttaggcaccccaacattctcagattatatggctacttccatgatgtgacaaga
gtctacctgatcctggagcacgcacctcgtggggaagtctacagggagcttcagaggctc
agcaagttcgatgagcaaagaactgctacttacatcacagaacttgcagatgccctctcc
tactgtcactccaagcgtgtgatccacagagacatcaagccagagaacttgctgctagga
tcaaatggagagttaaaaattgctgactttgggtggtctgtgcatgctccatcttctagg
agaacaactctctgtgggacacttgactacctgcctcctgaaatgattgagggaagaaca
catgatgaaaaggtggatatttggagtctgggagttctgtgctacgagttccttgtaggg
aaaccaccttttgaaacagaaacctatcaagaaacctacagagctatttccagggtggaa
ttcaagtttcctccatttgtaacagaaggtgcaagggatttaatttccaggctcctgaag
cacaaccccttccatcgcctgcccctgaaggatgtgcttctccatccctggatcacagca
aactctaccaagattcccaccagcaggaagagtgatgctgctgccccatccaaaacatag

DBGET integrated database retrieval system