KEGG   Taeniopygia guttata (zebra finch): 100221973Help
Entry
100221973         CDS       T01082                                 

Gene name
AURKA
Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100221973 (AURKA)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100221973 (AURKA)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100221973 (AURKA)
Protein phosphatases and associated proteins [BR:tgu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100221973 (AURKA)
Chromosome [BR:tgu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100221973 (AURKA)
   Spindle formation proteins
    100221973 (AURKA)
  Sister chromatid separation proteins
   Aurora kinases
    100221973 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
20
AA seq 319 aa AA seqDB search
MKENHAACPRPRRQAQNPEAESTSKQKTEETKKKSEETKKRQWSLDDFEIGRPLGKGKFG
NVYLAREKQSKFILALKVLFKTQLEEAGVEHQLRREVEIQSHLRHPNILRLYGYFHDVTR
VYLILEHAPRGEVYRELQRLSKFDEQRTATYITELADALSYCHSKRVIHRDIKPENLLLG
SNGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRTHDEKVDIWSLGVLCYEFLVG
KPPFETETYQETYRAISRVEFKFPPFVTEGARDLISRLLKHNPFHRLPLKDVLLHPWITA
NSTKIPTSRKSDAAAPSKT
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagaaccacgccgcctgcccccggccgcgccgccaagcacaaaatcctgaagca
gaaagcacctctaaacagaaaactgaagagaccaagaagaaaagtgaagagactaaaaaa
aggcaatggtcccttgatgattttgaaattggtcgtcctctggggaaaggaaaatttggg
aatgtgtacctggcacgtgaaaaacagagcaaatttattcttgcactgaaagtgctcttt
aaaacacagcttgaggaagctggtgtagagcatcaactacgaagagaagtggaaatacag
tctcatcttaggcaccccaacattctcagattatatggctacttccatgatgtgacaaga
gtctacctgatcctggagcacgcacctcgtggggaagtctacagggagcttcagaggctc
agcaagttcgatgagcaaagaactgctacttacatcacagaacttgcagatgccctctcc
tactgtcactccaagcgtgtgatccacagagacatcaagccagagaacttgctgctagga
tcaaatggagagttaaaaattgctgactttgggtggtctgtgcatgctccatcttctagg
agaacaactctctgtgggacacttgactacctgcctcctgaaatgattgagggaagaaca
catgatgaaaaggtggatatttggagtctgggagttctgtgctacgagttccttgtaggg
aaaccaccttttgaaacagaaacctatcaagaaacctacagagctatttccagggtggaa
ttcaagtttcctccatttgtaacagaaggtgcaagggatttaatttccaggctcctgaag
cacaaccccttccatcgcctgcccctgaaggatgtgcttctccatccctggatcacagca
aactctaccaagattcccaccagcaggaagagtgatgctgctgccccatccaaaacatag

DBGET integrated database retrieval system