KEGG   Taeniopygia guttata (zebra finch): 100221974Help
Entry
100221974         CDS       T01082                                 

Gene name
C1GALT1
Definition
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100221974 (C1GALT1)
Enzymes [BR:tgu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     100221974 (C1GALT1)
Glycosyltransferases [BR:tgu01003]
 Glycan extension
  Type 3 chain
   100221974 (C1GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 366 aa AA seqDB search
MASSKSLVNFLTFTFGSAIGFFVCYLLFNIILEEQVQIQPHVLHNDPHGQHSADTDNNQL
QGQMDFNADVGQHKDEDKNIAEGLYHKVKILCWVMTGPQNLEKKAKHVKATWAQRCNKVL
FMSSEENKDFPAVGLETKEGRDQLYWKTIKAFQYVYDHYFDDADWFMKADDDTYVILDNL
RWLLSKYSPEQPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVAAFKTNKCTHSSSVE
DLALGKCMEIINVEAGDSRDTSGRETFHPFVPEHHLIRGYLPKTFWYWNYNYYPAVEGPG
CCSDLAVSFHYVDSVTMYHLEYLIYHLRPYGYLYRYNPDSSKNSEEQSKNEALENNQKLK
QKTSES
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttctaaatctttggtgaactttctaaccttcacttttggctcagcaatagga
ttttttgtctgctatcttctgtttaacattatcctagaagaacaggttcagatccagcct
catgttcttcacaatgatccacatgggcaacactctgcagatactgacaacaatcagctg
caaggacaaatggatttcaatgcagatgttggacagcataaagatgaggataaaaatatt
gcagaaggactgtatcacaaggtgaaaatactgtgttgggtaatgactggacctcaaaat
ctagaaaagaaagccaagcatgttaaggccacttgggcccaacgctgtaataaagtactt
tttatgagctctgaggaaaataaagacttcccagctgtgggcctagaaaccaaagaaggc
agggaccaactctactggaagactattaaagcttttcaatatgtatatgaccattatttt
gatgatgctgattggtttatgaaagcagatgatgatacatatgttatactggacaatttg
agatggcttctttcaaaatacagtcccgaacaaccaatctactttggaagaaggtttaag
ccttatgtgaagcagggctacatgagtggaggagcagggtatgttctgagcaaagaagct
ctgaagagatttgttgctgcatttaaaacgaacaaatgcactcacagttcctctgttgaa
gatctggcactaggaaaatgcatggagatcatcaatgtggaagcaggggattctagggat
acaagtggtagagaaacctttcatccatttgttccagaacatcacttaatcagaggatac
ctaccaaaaacattctggtactggaattacaattactatcctgctgtagagggtcctgga
tgctgctccgatctagcagtttcattccactatgttgactctgtgactatgtatcatttg
gaatatttgatttatcatcttcgtccatatgggtatttgtataggtataatcctgattca
tcaaagaattcagaagagcagagcaaaaatgaagcactggagaataatcaaaagctaaag
caaaaaacttctgagagctaa

DBGET integrated database retrieval system