KEGG   Taeniopygia guttata (zebra finch): 100222032Help
Entry
100222032         CDS       T01082                                 

Gene name
P4HB
Definition
(RefSeq) prolyl 4-hydroxylase, beta polypeptide
  KO
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100222032 (P4HB)
Enzymes [BR:tgu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100222032 (P4HB)
Chaperones and folding catalysts [BR:tgu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100222032 (P4HB)
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100222032 (P4HB)
  Exosomal proteins of colorectal cancer cells
   100222032 (P4HB)
  Exosomal proteins of bladder cancer cells
   100222032 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
18
AA seq 666 aa AA seqDB search
MDKCSEAVNALCSAQSRALMLSLNGPRSAWGHEEPPRRCLLQCRGAASAARAPPAHLRDW
RACSKAKLDGSSRNRAGANGDLRAGSGADGQPEAADEGRARTASQWAVRSGRGSGPGQWE
AGGATNSGRQRAAGRAYKGEAAPCPRVCPSSSRRPPSAMAAVRALLPLLCLALLLPARAA
TEEEEDGVLLLPAISFEQELAEHRYLLFEFCEPGGDGPGQRMYHLWRTKGRSTNEAVNHS
NLAGPRPGVGEARPPLTPHPADAPWCGHCKALAPEYAKAAAKLKAEGSEIRLAKVDATEE
SDLAQQFGVRGYPTIKFFKNGDKAAPKEYTAGREADDIVSWLRKRTGPAAATLTDVADAE
ALVDSSEVVVIGFFKDLASEAAKEFLLAAETVDDIPFGISSSADVFSKYQISKDGVILFK
KFDEGQNNFEGDFKKDNLLNFIKSNSLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSD
YQGKLDNFKNAAGNFKGKILFIFIDSDHSDNQRILEFFGLKKEECPAVRLITLEEEMTKY
KPESDELTADKIKEFCNKFLAGKIKPHLMSQDLPEDWDKQPVKVLVGKNFEEVAFDENKN
VFVEFYAPWCGHCKQLAPIWDKLGETYRDHENIVIAKMDSTANEVEAVKIHSFPTLKFFP
AGSGRN
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggacaagtgttctgaagcggttaatgccttatgctccgctcagagccgtgctctgatg
ctgagcctcaacgggccccgctcggcctgggggcacgaggagcccccgcgacggtgcctt
ctccagtgccgcggggccgccagcgccgcccgagcccccccggcccatctccgtgactgg
cgagcttgcagcaaagccaaactggacggctcaagccgcaaccgggccggggccaatgga
gacctgcgggcggggagcggggccgacggccaacccgaggcggcggacgagggacgtgcc
cggaccgccagccaatgggcggtgcgcagcggccggggcagcggccccggccaatgggag
gcgggcggcgcaaccaatagcgggcggcagcgggcggcggggcgggcctataaaggagag
gcggcaccgtgcccgcgcgtctgtcccagctcgtcccgaaggccgccatcagccatggcg
gcggtgcgcgctctgctcccgctgctctgcttggccctgctgctgcccgcccgcgccgcc
acggaggaggaggaggatggtgtcctgttgttgcccgccatctccttcgagcaggagctg
gccgagcaccgatacctgctcttcgagttctgtgagcccggcggggacgggcctgggcaa
cggatgtatcacctttggcgaactaaaggaagaagcaccaatgaggctgtaaatcactcc
aacctggcggggccacggccaggagtcggggaggcccggccgccgctgacgccccacccc
gcagacgccccgtggtgcgggcactgcaaagcgctggcgcccgagtacgcgaaggcggcg
gcgaagctgaaggcggagggctcggaaatccggctggccaaggtggacgccacagaggag
tcggacctggcgcagcaattcggcgtacgcgggtatcccaccatcaagttcttcaagaac
ggcgacaaagctgcgcccaaggagtacacggctggcagggaagcggatgacatcgtcagc
tggctgaggaagcgcacgggcccagctgctgccaccctgactgatgtggctgatgcagag
gcactggtggactccagtgaagtggtggtgattggtttcttcaaggatttggcatcagag
gcagcaaaggagttcctgctggcagcagaaactgtggatgatattccttttgggatttcc
tccagtgctgatgtcttctccaagtaccagattagtaaggacggtgtgatcctcttcaag
aagtttgatgaaggccagaacaactttgaaggggatttcaaaaaagataatctgctgaac
ttcatcaagtctaattcattgcctctggtcatagagttcactgaacagactgctcctaaa
atatttggaggagagatcaagactcatattctgcttttcctaccaaaaagtgtgtctgac
tatcaagggaagctggacaacttcaagaatgcagctgggaacttcaaagggaagatcctg
ttcatcttcatagacagtgaccacagtgacaaccagaggattttggagttctttggccta
aagaaggaagagtgtccagctgtacgtcttatcaccctggaggaagaaatgaccaaatac
aaacctgaatctgatgagctcacggcagacaagatcaaagagttctgtaacaaattcctg
gcaggcaagatcaagccccatctaatgagtcaggatcttcctgaagactgggacaagcag
cctgtcaaagttctggttgggaagaactttgaagaagttgcttttgatgagaataagaat
gtctttgtggagttctatgccccatggtgtggtcactgcaagcagctggccccaatctgg
gacaagctgggagaaacctacagggaccatgagaacattgtcattgccaagatggactcg
acagctaatgaagtggaggcagtgaaaatccacagcttccccacactcaagttcttccct
gcaggctctggcagaaattga

DBGET integrated database retrieval system