KEGG   Taeniopygia guttata (zebra finch): 100222320Help
Entry
100222320         CDS       T01082                                 

Definition
alcohol dehydrogenase 1-like
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tgu00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:tgu00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:tgu00350]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:tgu00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:tgu00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:tgu00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 374 aa AA seqDB search
MATAGKVIRCRAAVAWAPGKPLSVEEVEVAPPKAGEVRIKIVATSICHTDDHVLKGSLQK
VEFPVIPGHEGAGIVESIGQGVTSVKPGDKVIPLCLPQCGECSFCQNPESNYCQKTHFSE
PQNLLPDKTSRFTCKGKQIHHYLWISTFAEYTVVPEYAVAKIDAAAPLDKVCLIACGFST
GYGAAINTAKVKPGSTCAIFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKARELGAT
DCINPRDFNKPTQEVLTEMTGQGVNYSFEAIGHVDTMIAALASCNASTGVCVMVGVLNSE
ISIDPVLLLTGRTWKGTLLGGWKTRECIPKLVSSYLEGKFNSDLLITHTLPFAKVNEGFE
LLRAGKSIRTVLLF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggccactgcgggaaaagttatcaggtgcagagctgctgttgcctgggccccaggcaaa
ccactgtctgttgaggaggtggaagttgcacccccaaaggcaggagaagtccggatcaag
attgtggccacaagcatctgtcacacagacgatcatgttttgaaaggatctttgcaaaag
gtggaattcccagttatccctggccatgaaggagctgggattgtggaaagcattggacaa
ggagtgacctctgtgaaaccaggagacaaagtgatcccactttgcctccctcagtgtggg
gaatgcagcttctgccagaatcctgaatccaactactgccagaagacccatttctctgaa
ccacaaaacctgctgccagacaagaccagccgcttcacttgcaaagggaagcagatccac
cactacctgtggatcagcacctttgcagaatacactgtggtcccagaatacgccgttgcc
aagatagatgctgcggcacctctggacaaagtctgcttgattgcctgtgggttttccaca
ggctatggggctgccatcaacacagccaaggtaaaaccaggctccacctgtgccatcttt
ggcctcggaggagttggcctctctgttgtcatgggctgcaaggcagctggagctgcccgc
atcattgccgtggacatcaacaaggacaagtttgccaaggccagggagctgggagccacc
gactgcatcaaccctcgagacttcaacaagcccacccaggaggtgctcactgagatgacc
gggcagggtgtgaactactcctttgaggccatcgggcacgtggacaccatgattgctgcc
ttggcttcctgcaatgccagcactggtgtctgtgtgatggttggggtgcttaattcagag
atttccattgatcctgtgcttctgctgactgggcgtacttggaaggggactttgcttgga
ggctggaagacgagagaatgtatccccaaattagtttccagctacttggaggggaagttc
aattcagacttgctgatcacgcacacgctgccattcgctaaagtgaacgagggatttgag
ttgttacgtgcaggaaaaagtatccgcactgtcctgctcttctga

DBGET integrated database retrieval system