KEGG   Taeniopygia guttata (zebra finch): 100222334Help
Entry
100222334         CDS       T01082                                 

Gene name
USP32
Definition
ubiquitin specific peptidase 32
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 1557 aa AA seqDB search
MTQQCFIREVLGDGVPPKVAEVIYCSFGGISKGLHFNNLIVGLVLLTRGREEEKTKYIFS
LFSNESGSYVVREEMEKMLHVVDGKVPESLKKCFSEGEKVNYEKFRVWLLHNKDAFTFSR
WLLSGGVYVTLTDDSDTPTFYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFA
PLVSPPIHQSLSEGLFNAFDENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRD
GVLSRTELKDMVVALLEVWKDNRTDKIPELDMGLSEIVEDILHVHDNTKLGHLTLEDYQI
WSVKSALANEFLNLLFQVCHIVLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFLIAM
PWWHQWKEYVKYDANPVVIEPSSVLSGGKNPLVAAAANTPEQGEDKMGGLNGFSAPEEKF
SDNISTASEASESTSSNTLYPGTPGSEVSFARQHNTSDNNNQCFLGSNGNTLLQLNPQKP
GAIDNQPLVTQEPVKAASLTMEGGRLKRSPQLVEGKDYVMVPEPVWRALYHWYGANLSLP
RPVIKNSKTNVPELELFPRYLLFLRQQPATRTQQSNVWVNMGNVPSPNAPLKRVLAYTGC
FSRMQTIKEIHEYLSQRLRIKEEDMRLWLYNSENYLTLLDDEDHRLEYLKIQDEQHLVIE
VRNKDMSWPEEMSFIANSSKIDRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTRY
FISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKNIAPLKLRWTIAKYAPRFNGF
QQQDSQELLAFLLDGLHEDLNRVHDKPYVELKDSDGRPDWEVAAEAWENHLRRNRSIVVD
LFHGQLKSQVKCKTCGHISVRFDPFNFLSLPLPMDSYMHLEITVIKLDGTTPVRYGLRLN
MDEKYTGLKKQLSELCGLKPEQILLAEVHSSNIKNFPQDNQKVRLSVSGFLCAFEIPIPG
SPTSASSPVQTETSTGPSANGAPSILMNGDVAKPSLIPNGMPNTVVPCGTERSPPSWTLN
GHVPSLCDSPCTGYIIAVHRKMMRTELYFLSSQKNRPSLFGMPLIVPCTVHTRKRDLYDA
VWIQVSRLASPLPPQEASNHAQDCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKI
ECTEDRACVGSAYIAVDWDPTALHLRYQTSQERIVEEHESVEQSRRAQAEPINLDSCLRA
FTSEEELGEDEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKF
PRENFDPSAFLVQRDPSHFQRKQLTLQVESLPEARPGQGDTRKADVQNTGTAGEGDTLNR
SPSSLNTTVLNNVKASPSLGRKSGTSCPSSKNSSPNSSPRTLGRGKGRLRLPQLGKNKLS
SSKENLAANRENGAEHEQGDALTKGQALGGSQSELYPGQDSEGALANGFLWEQSSLSNGQ
GENHSEDDTADDQRDDGWLSPIYNLYAISCHSGIMGGGHYVTYAKNPNNKWYCYNDSSCK
ELHPDEIDTDSAYILFYEQQGVDYAQFLPKIDGKKMADTSSMDEDFESDYKKYCVLQ
NT seq 4674 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcagtgcttcatcagggaagttctgggtgatggggtccctcccaaagttgct
gaggttatctactgttcatttggaggaatatccaaagggctgcacttcaataacttgata
gttggattagttctactcacaagaggcagagaggaggagaaaacaaaatatattttcagc
ctcttctctaatgaatctgggagttatgttgtccgtgaagagatggagaagatgctgcat
gtggttgatgggaaagtcccagagtcactcaagaaatgtttctctgagggtgagaaggtg
aactatgagaagttcagggtttggctgctgcacaacaaagacgctttcaccttctcgcgg
tggctgctctcaggaggggtctacgtgaccctcactgatgacagtgacaccccaaccttc
taccagaccctggctggagtcacacacttggaagaatccgacatcatcgacctggagaag
cgatactggctgctgaaagctcagtccaggactggacgcttcgatttggagacatttgcc
cccttagtgtcccccccaatccatcaatccctgagtgaaggtttgtttaatgcttttgat
gaaaaccgagacaatcacatagattttaaagaaatttcctgtgggctctcagcatgttgc
aggggacccttggcagagagacagaagttttgcttcaaggtgtttgacgtggaccgcgat
ggggtcttgtctcgcaccgagctcaaggacatggtggtggcacttttagaggtctggaaa
gacaacaggacagacaaaatacctgagttggacatgggtttgtctgaaattgtggaagat
attttacatgtgcatgataacacaaagcttggacaccttactctggaagactaccagata
tggagtgtgaagagtgctcttgccaatgaatttttaaatctgctttttcaggtgtgtcac
atagttctgggactgcgacctgccaccccagaggaggaaggacagattattagaggctgg
ttggaaagagagagcaggtatggcctccagccagggcacaactggtttctcattgctatg
ccctggtggcaccagtggaaagaatatgtcaaatatgatgcaaacccagttgtgatagag
ccttcatctgtcttgagtggaggtaagaatcccctggtagctgctgcagccaatacccca
gaacagggagaagacaaaatgggaggtcttaatggcttcagtgcaccagaagaaaagttt
tcagataatatttccactgcctcagaagcctcagagtccaccagcagcaatactctgtac
cctggcaccccaggctctgaggtgagctttgcaaggcagcacaacacttcagacaataac
aaccagtgtttccttggatccaatgggaatactctgcttcagctgaacccccagaaacca
ggagctattgataaccagcccctggtcacccaggagccagtcaaggctgcatcattaact
atggagggtggaaggttgaagagatctccacagctggtggaaggaaaggactatgtcatg
gtgccagaaccagtttggagagcactttaccactggtatggagcaaacctgtccttgccc
aggccggtgatcaagaacagcaagaccaacgtgcccgagctggagctgttccctcgctac
ctgctgttcctgcggcagcagccggccacgcgcacccagcagtccaacgtctgggtcaat
atggggaatgtcccttccccaaatgctcctttgaagagggtgctggcttacactggctgc
ttcagtcggatgcaaaccatcaaagagatccacgagtacctgtcccagaggctgcggata
aaggaggaggacatgcgcctctggctctacaacagtgagaactatctcactttgctggat
gatgaagatcatagactggaataccttaaaatccaagatgagcagcatttagtaatagaa
gttcgaaacaaagacatgagctggccagaagagatgtcttttatagcaaacagcagtaaa
atagacagacacaaagttcctactgagaagggtgctacaggcctgagcaacctggggaac
acgtgcttcatgaactccagcatccagtgtgtcagcaacacgcagcccctgacccgttac
ttcatctcagggaggcatctctacgagctgaacaggacaaatcccataggaatgaaagga
cacatggccaagtgctatggggatttggtgcaggagctgtggagtggcacccagaagaac
atcgcccccttaaagctgaggtggacaatagcaaaatatgctccaagatttaatggcttt
caacagcaagactcacaggagcttctggcttttcttctggatgggctccatgaggacttg
aacagagttcatgataagccatatgtggaactgaaggacagtgatggtcggccagactgg
gaggtagcagcagaggcctgggaaaaccatctgagaagaaacagatccattgttgtagat
ttatttcatgggcagctgaagtcacaagtgaaatgtaaaacttgtgggcatataagtgtt
aggtttgacccttttaattttttatccttgcctttgccaatggacagctacatgcaccta
gaaattacagtaattaaattagatggcactactcctgttcgatatgggctgagattgaac
atggatgagaagtacacaggcttgaaaaaacagctgagtgaactctgtggcctcaaacca
gagcagattctgcttgcagaggtgcacagctccaatataaagaacttccctcaggacaac
cagaaggtccggctgtctgtgagcggcttcctgtgtgcgtttgagatccccatcccaggc
tcccccacgtcagcatccagccctgtgcagacagagacctcaactgggccatcagccaac
ggagcccccagcatcctgatgaacggggacgttgccaagccaagcctcattcccaatggg
atgccaaacactgtggtgccatgtgggacggagcgcagcccgcccagctggaccctcaac
ggccacgtgccctcgctgtgtgacagcccctgcacaggctacatcattgcagtgcacagg
aaaatgatgaggacagagctgtattttctctcatctcagaagaatcggcccagtctcttt
ggaatgccattgattgttccctgcacagttcacacacggaaaagggacctctatgatgct
gtgtggatccaggtgtccaggctggccagccccctccctcctcaggaagccagtaaccat
gcacaggactgtgatgacagcatggggtatcaataccccttcaccctcagggtagttcag
aaggatggaaattcttgtgcttggtgtccatggtacaggttctgccgtggctgtaagatt
gagtgcacagaggacagggcttgtgtgggcagtgcctacattgctgtggactgggacccc
accgcgctgcacctgcgctaccagacctcacaggaacggatcgtggaagaacatgaaagt
gttgaacaaagccgccgagcccaggcagagcccatcaacctggacagctgtctgagagcc
ttcaccagcgaggaggagctgggggaggatgagatgtactactgctccaagtgcaagacc
cactgtctggccaccaaaaaactggatctttggagacttccccctattttgatcattcac
ctgaaaagatttcagttcgttaatggccgctggataaaatcccagaaaattgttaaattt
cccagagaaaattttgacccaagtgcctttttggtacaaagggatccgagtcatttccaa
aggaagcagctcaccctgcaggttgagagccttcctgaagcacggcctggccaaggggac
accaggaaagcagatgtgcagaacactggcacagcaggagaaggggacactctgaacagg
agtccatcctccctaaacactactgtcctcaataatgtcaaagcatctccatccttgggg
cggaaaagtggaaccagctgcccctcaagtaaaaacagcagccccaacagcagcccaagg
actttggggagaggcaaagggcgcctgcggctgccccagctggggaaaaacaaactgtcc
agcagcaaggaaaacctggctgcaaacagggagaacggtgctgagcacgagcagggggat
gctctgactaaaggacaggctttggggggcagccagagcgagctgtaccccgggcaggac
agcgagggggctctggccaacgggttcctgtgggagcagagctcgctcagcaacgggcag
ggcgagaaccacagcgaggacgacaccgccgacgaccaaagagacgacggctggctcagc
cccatctacaacctatatgcaatctcgtgccattcaggaattatgggagggggtcattat
gtcacttatgccaaaaacccgaacaacaagtggtactgctacaatgacagcagctgcaag
gagttgcacccggacgagatcgacacggactctgcctacattctgttctacgagcagcag
ggggtggactatgcccagttcctgcccaagatcgatggcaagaagatggcagacacgagc
agcatggacgaggacttcgagtccgactacaagaagtactgcgtgctgcagtga

DBGET integrated database retrieval system