KEGG   Taeniopygia guttata (zebra finch): 100222362Help
Entry
100222362         CDS       T01082                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1-like
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100222362
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100222362
   04370 VEGF signaling pathway
    100222362
   04020 Calcium signaling pathway
    100222362
   04070 Phosphatidylinositol signaling system
    100222362
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100222362
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1167 aa AA seqDB search
MSMARLNSVNGFLEDTRMEPGDMGRILRCLEMGTVLTLFYQKKSQRPERRTFQVKLETRQ
IIWSRTPEKVEGDRQWRQCGEEFGDRVLTGSRQIRCRCGFQEAAAWECGPPELCQVSLYD
FQKFLLHDQKESWASDVGVVRDYMCSYLKESSNEASDPSFQLDEFLTYLFSKENMVMDAK
YERVVPEEMNHPLSQYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPD
DLPIIYHGHTLTSKIKFLDVLHTIKEHAFVTSEFPIILSIEDHCSIVQQRNMACHFKKVF
GDMLLTKPVDINADELPSPTQLKKKILIKHKKLVEGNLYEEVSTASYSENDISNSIKNGI
LYLEDPIDHTWSPHYFVLTSNKIYYSEETSRYQFNEDEEEVEQKEEFNNNELHFTEKWFH
GKLGGGRDGRQIAEKLLHEYCTETGGKDGTFLVRESETFVGDYTLSFWRSSRVQHCRIHS
RQEAGATKFYLTDNLVFDSLYSLICHYREVPLRCNEFEMRLTDPVPQPNAHESKEWYHAS
LTRLQAEHMLMRVPRDGAFLVRKRSEPNSYAISFRKCTVKALYDYKAQREDELSFCKQAI
IHNVDKQDGGWWRGDYGGKKQLWFPANYVEEIVGTQAQEQDEASSENSPLGNFLKGFIDV
PSCHVVISKDGRSSKPFVFTIHSQQMSHAAQSLDVAADTQEELSEWVAKIREATQNADAR
MQEGKIMERRKKIALELSELVVYTKAEKYANRSKGKKFLQYNRRQLSRIYPKGQRLDSSN
YDPLPMWICGSQLVALNFQTPEIGTDKACYRDMSSFPETKAEKYANRSKGKKFLQYNRRQ
LSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQLNQALFMLGGRSGYVLQPD
IMRDETFDPFDKNSLKIVEPITVQLQILGARHLPKNGRSIVCPFVEVEVCGSEYDNSKNK
TDVVADNGFNPVWLFKQFVFDINNPEFAFLRFVVYEEDMFSDPNFLAQATFPVKGLKTGY
RSVPLKNSYTEDLELASLLIHIEIINAKEEDEENLYSSIQQLRDRASELSSQVSSYERTN
GCDSRYQQRLDELRAAQERLMELTEVRNRKPVTGGGARCLATPLLPLVIPPLHSYWFSSS
PRRSLLAGGPRARSDAEVAGPERRRRR
NT seq 3504 nt NT seq  +upstreamnt  +downstreamnt
atgtccatggccaggctcaacagcgtcaatggcttcttggaggacaccaggatggagccg
ggggacatgggcaggatcctgcgctgcctggagatgggaaccgtcctcaccttgttctac
cagaagaaatcgcagaggccggagagaaggaccttccaggtgaagctggagacgcgacag
atcatctggagccggacgcccgagaaggtggagggggacagacaatggagacaatgcggg
gaggagtttggagacagagttctgacaggatcgaggcaaatccgctgcagatgtggtttc
caggaagctgctgcttgggaatgtggaccgcctgagctgtgccaagtgtccctctacgac
ttccagaagttcctgctgcatgaccagaaggaatcctgggccagtgacgtgggcgtggtg
cgggactacatgtgctcctacctcaaggagagctccaacgaagcgtcggatccctccttc
cagctggatgagttcctcacatacctcttctccaaggaaaacatggtgatggatgctaag
tacgagcgtgtggtgcctgaagagatgaaccaccccttgtcccagtactggatctcctca
tcccacaacacgtacctgacaggagaccaattctccagcgagtcctccctggaggcgtac
gcccggtgcctgcggatgggctgccgctgcatcgagttggattgctgggatggcccggac
gatctccccatcatctaccatggccacacgctcacctccaagatcaaattcctggatgtg
ctgcacaccatcaaggagcacgccttcgtcacctctgagttccccatcatcctctccatc
gaagaccactgcagcatcgtccagcagaggaacatggcctgccacttcaagaaggttttt
ggggacatgctcctcaccaagccagtggacatcaacgctgatgagctgccctcgcccacc
cagctgaagaagaaaatcctaatcaagcacaagaaactggtcgaagggaacctgtacgag
gaggtctccactgccagttactcagagaacgacatcagcaactccatcaagaatggaatt
ctctaccttgaagaccccattgaccacacctggagccctcattattttgtcctgacaagc
aacaagatttactactcagaggagacatcccgctaccagttcaacgaggatgaagaggag
gtggagcagaaggaggagttcaacaacaacgagctgcacttcacggagaagtggttccac
ggcaagctcgggggtggccgtgacgggcgacagattgcggagaagctgctgcatgagtac
tgcaccgagacgggcggcaaagacggcaccttcctggtgcgcgagagcgagaccttcgtg
ggcgactacaccctctccttctggaggtccagccgggtgcagcactgccggatccactcg
cggcaggaggccggggccaccaagttctacctgacggacaacctggtcttcgacagcctc
tacagcctcatctgccactaccgggaggtgccgctgcgctgcaacgagtttgagatgcgc
ctcaccgaccccgtcccccagcccaacgcccatgagagcaaagagtggtaccatgccagc
ttgacacgtctccaggccgagcacatgctgatgcgggtcccccgggatggagcattcctg
gtgcggaagcgcagcgaacccaactcctacgccatctccttccgcaagtgcacggtgaag
gctctgtatgactacaaagcacaacgggaggacgagctgtcgttctgcaagcaggccatc
atccacaacgtggacaagcaggacggcggctggtggcgaggggactacgggggcaagaag
cagctctggttcccggccaactatgtggaggagatcgtcggcacccaggcgcaggagcag
gatgaggcctcatcagaaaacagccccctggggaacttcctgaagggcttcatcgatgtc
ccatcctgccacgtcgttatctccaaagacgggaggagctccaaaccatttgtcttcacc
atccattcccagcagatgtcccacgcagcccagtcgctggacgtggccgcagacacgcag
gaggaactcagcgagtgggtggccaagatccgggaggccacgcagaacgccgacgccagg
atgcaggaagggaagatcatggagcggaggaagaagatcgccctggagctctcggagctg
gtcgtgtataccaaggcggagaaatacgccaaccgcagcaagggcaagaagttcctgcag
tacaaccgccggcagctgagccgcatctaccccaaaggacagcgcctggactcctccaac
tacgacccactgcccatgtggatctgtgggagccaactcgtggccctcaacttccagacg
cccgagattggcacggacaaggcttgttaccgggacatgtcctccttcccggagaccaag
gcggagaaatacgccaaccgcagcaagggcaagaagttcctgcagtacaaccgccggcag
ctgagccgcatctaccccaaaggacagcgcctggactcctccaactacgacccactgccc
atgtggatctgtgggagccaactcgtggccctcaacttccagacgcctgacaaaccgatg
cagctgaaccaggcgctcttcatgctcggtggccgcagcggctacgtcctacagccggac
atcatgagggacgagacctttgaccccttcgacaagaacagcctgaagattgtggagccc
atcacagtccagctgcagatcctcggtgcccggcacctgcccaagaacgggaggagcatt
gtgtgccccttcgtggaggtggaggtttgtggctccgagtatgacaacagcaagaacaag
acggatgtcgtagctgacaatggcttcaaccccgtctggctcttcaagcagttcgtcttc
gacatcaacaaccccgagtttgccttcctccgcttcgtggtgtatgaggaggacatgttc
agtgaccccaacttcttggcacaagccaccttccctgtcaagggcctcaaaacaggctac
cggtcggtgcctttgaagaacagctacaccgaggacctggagcttgcctccctcctcatc
cacatcgaaatcatcaacgccaaggaggaagatgaggagaacctctactcgtccatccag
cagctccgggaccgtgccagcgagctctccagccaggtctccagctacgagcgcaccaac
ggctgcgattcccgctaccagcagcgcctggacgagctccgggcggcccaggagcggctc
atggagctcactgaagtccgcaaccgcaagccggtgacagggggcggagcccgctgctta
gccacgccccttctcccgcttgtgatcccgccccttcactcctattggttctcatcctct
ccccgccgctccctattggctggcgggccgcgcgcgcgctcggacgcggaagtggcgggg
ccggagcggcggcgcagacggtga

DBGET integrated database retrieval system