KEGG   Taeniopygia guttata (zebra finch): 100222415Help
Entry
100222415         CDS       T01082                                 

Definition
cytochrome P450 2D3-like
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100222415
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100222415
Cytochrome P450 [BR:tgu00199]
 Cytochrome P450, animal type
  CYP2 family
   100222415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1A
AA seq 507 aa AA seqDB search
MALLLWLGSQLSSIWSNISILGVFLTVFALLLDFLKRRKKWSRYPPGPASLPFIGTMFSI
DFHNPHHSFGQLQKKFGNIFSLQNCWTNLVVLNGYKTVKEALVHKSEDFADRPHFAIYEH
MGYGKNSEGIVVARYGHVWKEIRRFALSTLRDFGMGKKSLEERVVEEAGFLCSEIKSKEG
KSFDIHVLINNAVCNMICNIVFGDRFDYGDKTFKKLSQLFQNSLNEETGFLPQLLNVVPI
LVHIPGVPQKIFRAQKELMDFIDVVLDKHMKTWDPAYTRDITDVFLQEMEKGKAAEENGF
HYNNLRMVTMDLFTAGSETTSTTLRWALLYMLLHPEIQSKVQAEIDGVIGRERPPTMKDQ
ASMPYTNAVIHEVQRYGDIVPVGVPHMTYRDTELQGFFIPKGTTVITNLSSVLKDETMWE
KPNEFYPEHFLDAKGQFVKPEAFLPFSAGRRACPGEQLARMELFLFFTTLLQKFTFVLAE
GQPRPRVDGHFALTRSPHPYLLQALPR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcattgctcctgtggctggggtcccagctgtcatccatctggagcaacatctctata
ctgggagtttttcttacagtgtttgctttactgctggacttcctgaagcgcagaaagaag
tggagccgttacccaccaggcccagcctcgctgccattcattgggaccatgttctccatt
gacttccacaacccccaccactcctttggccagctccagaagaagtttggaaacatcttc
agtctccagaactgctggaccaacctagtagtgctgaatgggtataaaacagtgaaggaa
gccctggtccacaaatcggaggactttgctgaccggccgcactttgcaatatacgagcac
atgggttatggaaagaattctgaagggattgttgtagcaagatacgggcacgtctggaag
gagataaggagatttgcgctctctacgctgagggactttgggatgggaaagaaatccctg
gaggagcgagtggtagaagaagctggatttctttgttctgaaatcaagtctaaagaaggt
aaatcttttgatatacatgttctcataaataatgctgtctgcaacatgatctgcaacatt
gtctttggagaccgttttgactatggtgataagacattcaagaagctgtcacagttattt
caaaattccttgaatgaagaaactggattcctgcctcagcttcttaacgtggtgcccatt
ttggtgcacatccctggagtgccacagaaaatctttcgagcacaaaaggaattaatggac
ttcatagatgtggtcttagataagcatatgaagacctgggaccctgcttacacccgagat
atcacggatgtgtttttacaggaaatggagaagggtaaggcagctgaagagaatggtttc
cactataacaaccttcgtatggtgaccatggacttgtttacagctggttctgagaccacc
tccaccactctccggtgggcattgctgtatatgcttctccacccagaaatacagagtaag
gtccaggcagagattgatggagtgattggcagagagagaccccccaccatgaaggaccaa
gctagcatgccttacactaatgctgtgatccatgaagtacaacgctacggggacattgtt
cctgttggggtacctcacatgacgtaccgggacactgagttgcaaggcttcttcattccc
aaggggacgacagtcatcaccaacttgtcttccgtgctgaaggatgagacaatgtgggag
aaaccaaacgagttttaccccgaacacttcctggatgcaaaggggcagtttgtgaaacca
gaagccttcctgcccttctcagcaggtcgccgtgcctgtccgggagaacagctggccagg
atggagctctttctcttctttaccactctcctgcagaaattcactttcgtgctcgctgag
ggccagcccaggccacgggtggacggtcactttgcactcactagatctccacacccatac
ctcttgcaagctctcccaagatag

DBGET integrated database retrieval system