KEGG   Taeniopygia guttata (zebra finch): 100222415Help
Entry
100222415         CDS       T01082                                 

Definition
cytochrome P450 2D3-like
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Steroid hormone biosynthesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:tgu00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1A
AA seq 507 aa AA seqDB search
MALLLWLGSQLSSIWSNISILGVFLTVFALLLDFLKRRKKWSRYPPGPASLPFIGTMFSI
DFHNPHHSFGQLQKKFGNIFSLQNCWTNLVVLNGYKTVKEALVHKSEDFADRPHFAIYEH
MGYGKNSEGIVVARYGHVWKEIRRFALSTLRDFGMGKKSLEERVVEEAGFLCSEIKSKEG
KSFDIHVLINNAVCNMICNIVFGDRFDYGDKTFKKLSQLFQNSLNEETGFLPQLLNVVPI
LVHIPGVPQKIFRAQKELMDFIDVVLDKHMKTWDPAYTRDITDVFLQEMEKGKAAEENGF
HYNNLRMVTMDLFTAGSETTSTTLRWALLYMLLHPEIQSKVQAEIDGVIGRERPPTMKDQ
ASMPYTNAVIHEVQRYGDIVPVGVPHMTYRDTELQGFFIPKGTTVITNLSSVLKDETMWE
KPNEFYPEHFLDAKGQFVKPEAFLPFSAGRRACPGEQLARMELFLFFTTLLQKFTFVLAE
GQPRPRVDGHFALTRSPHPYLLQALPR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcattgctcctgtggctggggtcccagctgtcatccatctggagcaacatctctata
ctgggagtttttcttacagtgtttgctttactgctggacttcctgaagcgcagaaagaag
tggagccgttacccaccaggcccagcctcgctgccattcattgggaccatgttctccatt
gacttccacaacccccaccactcctttggccagctccagaagaagtttggaaacatcttc
agtctccagaactgctggaccaacctagtagtgctgaatgggtataaaacagtgaaggaa
gccctggtccacaaatcggaggactttgctgaccggccgcactttgcaatatacgagcac
atgggttatggaaagaattctgaagggattgttgtagcaagatacgggcacgtctggaag
gagataaggagatttgcgctctctacgctgagggactttgggatgggaaagaaatccctg
gaggagcgagtggtagaagaagctggatttctttgttctgaaatcaagtctaaagaaggt
aaatcttttgatatacatgttctcataaataatgctgtctgcaacatgatctgcaacatt
gtctttggagaccgttttgactatggtgataagacattcaagaagctgtcacagttattt
caaaattccttgaatgaagaaactggattcctgcctcagcttcttaacgtggtgcccatt
ttggtgcacatccctggagtgccacagaaaatctttcgagcacaaaaggaattaatggac
ttcatagatgtggtcttagataagcatatgaagacctgggaccctgcttacacccgagat
atcacggatgtgtttttacaggaaatggagaagggtaaggcagctgaagagaatggtttc
cactataacaaccttcgtatggtgaccatggacttgtttacagctggttctgagaccacc
tccaccactctccggtgggcattgctgtatatgcttctccacccagaaatacagagtaag
gtccaggcagagattgatggagtgattggcagagagagaccccccaccatgaaggaccaa
gctagcatgccttacactaatgctgtgatccatgaagtacaacgctacggggacattgtt
cctgttggggtacctcacatgacgtaccgggacactgagttgcaaggcttcttcattccc
aaggggacgacagtcatcaccaacttgtcttccgtgctgaaggatgagacaatgtgggag
aaaccaaacgagttttaccccgaacacttcctggatgcaaaggggcagtttgtgaaacca
gaagccttcctgcccttctcagcaggtcgccgtgcctgtccgggagaacagctggccagg
atggagctctttctcttctttaccactctcctgcagaaattcactttcgtgctcgctgag
ggccagcccaggccacgggtggacggtcactttgcactcactagatctccacacccatac
ctcttgcaagctctcccaagatag

DBGET integrated database retrieval system