KEGG   Taeniopygia guttata (zebra finch): 100222432Help
Entry
100222432         CDS       T01082                                 

Gene name
UROS
Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100222432 (UROS)
Enzymes [BR:tgu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     100222432 (UROS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 268 aa AA seqDB search
MKVLLLKDPKDKDSGPDPYIKELGSYSLEATLIPVLSFDFTSLESLFGKLSHPECYGGLV
FTSPRALEAIKICLKEKSKKEAWSNSLKQMWNIKPTYVVGKATASLVEEIGLVPQGEKAG
NAEKLAEYICSKKPNSSALLFPCGALKREVLPTVLREKGIPLESLTVYQTAQHPDLQESL
SSYFSQQGIPASVVFFSPSGVKFCLQHIQKLSGDLINQIKFAAIGPSTAEALRGAGVSVS
CTAGSPTAQDLAAAIHTALQPHPCSGPQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttttgctgctaaaagatcccaaagacaaagattcaggaccagatccatatatt
aaagaattaggatcatacagcttggaagcaacattgatcccagttttgtcatttgacttc
acctctcttgagagcttatttgggaagctttcccatccagagtgctatggaggcctagtt
tttaccagcccaagagcattagaagccatcaagatatgtttgaaagagaagagtaaaaaa
gaagcctggtcaaattctcttaaacaaatgtggaatatcaaaccaacatatgtggtagga
aaagctacagcttctttagtggaagaaattggtcttgttccacaaggagaaaaggctgga
aatgctgagaaattagctgaatatatttgttcaaagaaacccaattcctcagctctccta
tttccttgtggagccctgaaaagagaagtacttcctacagtgcttagagaaaaaggcata
cccctggaaagcctcactgtttatcaaacagcccaacaccctgatctgcaggagtccttg
agcagttacttctcccagcaggggatccctgcgagcgtcgtgttcttcagcccctcgggt
gtcaaattctgcctccagcacatccagaagctttcaggggatttgatcaaccagatcaag
ttcgctgccatcggccccagcacagcagaggccctgcgaggggctggcgtgtccgtgagc
tgcactgcagggagccccacggcccaggacctggctgctgccatccacacagccctgcag
ccacacccctgctctgggccccagtga

DBGET integrated database retrieval system