KEGG   Taeniopygia guttata (zebra finch): 100222557Help
Entry
100222557         CDS       T01082                                 

Gene name
USP8
Definition
ubiquitin specific peptidase 8
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100222557 (USP8)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100222557 (USP8)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100222557 (USP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 1087 aa AA seqDB search
MPAVASVPKELYLSTSLKDLNKKTEVKPEKTSTKSYVQSALKIFKAAEESRLDGDEEKAY
ILYMKYVAVYNLIRKRPDFKQQQDYFHSILGPTNLKKALDEAEILSDSLKLRYEEAEVRK
KLEERDRQELQKKQDPKDDGKSSAKNSSESVVDAKGKSQRINGETKHSLERKDQSDSLSG
AVTPEKLFAMMSDKNIELLIMDARRSKDYQESCIPKSISVPEEAIHPGDTAYLIEARLPE
ESRDPWKRRGQFHYVILLDWFSSAEDLKLGTTLQSLKDALFKWESKTILQNEPLILEGGY
ENWLLCFPQYTTNARVTPPQHGRTEAVTVSLDFTYPSLEEPTPVPPVVAENEEMGDNLEE
RLKSLNRPNIQDAAVPKADSSFVVNPMSITRSIPEVDRSKKPSLKILGDNRAKPPSTISD
SHSGESGRIVPDRSTKPVHDGRSTLTEEEKSRVHAETAALLEKNRREKELRERQQQEQKE
RLKREKEEQEQKEQEQKAKEEQKEKERKEKLQQSKEDREQKERDEQIKREQEEKEQERGH
RETVEAKKQNKNEPENIGAKRIEVDKISMEEREKGSRTPETQKRALGDASPTFVTVPGKS
QREPLIRARSEEMGRIVPGLPAGWVKFLDDITGTYRYYHSPTNTVQMYPPEMAPPATPPS
TPPSRKAKPKVTAEREREHSKLKRSYSSPDITQAIQEEDKKRVPVTPAVNRDNKPTCYTK
AEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLAEYFNRNLYQ
ADINRSNFLGHKGEVAEEFGVIMKALWAGQYKYISPKDFKITIGKINDQFSGYSQQDSQE
LLLFLMDGLHEDLNKADNRKRYKEENNDHLDDSSAAEIAWHKHKQLNESIIVALFQGQFK
STVQCLTCHKRSRTFEAFMYLSLPLASSSKCTLQECLRLFSKEEKLTDNNRFYCSHCKTR
RDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLETLDLSQYVIGPKTSLKRY
NLFSVSNHYGGLDGGHYTAYCKNASKQRWFKFDDHEVSEISASSVKSSAAYILFYTSYEQ
RAVDMAT
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtggcgtctgtacctaaggagctatacctctctacttcattgaaagatctc
aacaagaagacagaagtaaaacctgaaaagaccagtacaaaaagttatgtgcagagtgcc
cttaagattttcaaggcagcagaggaaagcagactggacggagatgaagaaaaagcttac
atcctctatatgaaatatgtggctgtttataaccttattagaaagagacctgattttaag
cagcagcaggattattttcattcaattctgggacctacaaatttaaaaaaagctcttgat
gaagctgaaatactgtcagacagccttaaactcagatacgaggaagctgaagttcggaaa
aaacttgaagagagggacagacaagaactgcaaaaaaagcaagatccaaaagatgatgga
aagagctcagccaaaaactcctcagaaagtgttgtggatgccaaaggaaaaagccaaagg
attaatggtgagacaaagcattcactggaaagaaaagatcagtctgatagcctgagtgga
gcagtcacacctgagaaactgtttgcgatgatgtcagacaaaaatattgaattgcttata
atggatgctcgaagatcaaaggattatcaggaatcctgtattccaaaatccatcagcgtc
ccagaagaagctatccatcctggagatactgcatatctgattgaagctagactcccagag
gagtctagggatccatggaagaggagaggacagttccattatgttatactgctagactgg
tttagttctgctgaagacttaaagttgggaacaactctacagagcctgaaagatgcactt
tttaagtgggaaagcaaaaccatcctacagaatgaacctttaattctagagggaggttat
gaaaactggctcctttgttttccccagtatacaacaaatgctagagtaactccaccccag
catggcaggactgaagcagtgactgtttctttggattttacatatccatctctggaagag
ccaactcctgtgccacctgttgttgctgaaaatgaagaaatgggagataatttggaagag
agactaaaatcacttaacagaccaaacatacaggatgctgctgttccaaaagctgacagt
tcctttgtagttaatcccatgtcaattacaagaagtatccctgaggtcgatcgttctaaa
aagccttcactaaaaatccttggtgataacagagcaaaacctccaagtacaatcagtgac
agccactctggtgagagtggaagaatagttccagaccgctccacaaagcccgtgcatgat
ggaaggagcactctgacagaagaagaaaaaagtcgggtccatgcggaaaccgcggctttg
ttagagaaaaacagacgggaaaaggaactgcgggagaggcaacaacaggaacagaaagag
aggctcaagagagaaaaagaagaacaagaacaaaaagaacaggaacaaaaggcaaaagaa
gaacagaaggaaaaggaacgcaaagaaaagctacagcaatcaaaagaggacagagagcag
aaggagagggatgaacaaataaaaagagagcaggaggaaaaggaacaagaaagaggacac
agagaaacagtagaagcaaaaaagcaaaataaaaatgaaccagaaaacattggtgcaaaa
aggattgaggttgacaaaatatccatggaagaaagagaaaagggatctcgaacaccagaa
acacagaaacgagcactgggtgatgcatctccaacctttgtaactgttccaggcaagtcc
cagcgggagccattaataagagcacgaagtgaggaaatgggaaggatagtcccagggctg
cctgcaggttgggtaaagttcctggatgacatcactggaacctatcgttactatcactca
ccaacaaatactgttcagatgtacccaccagaaatggctcctccagccactcctccatca
acccctcccagtcggaaagccaagccaaaggtgactgctgagcgggagagagagcactcc
aagctgaagcgctcctactcgtccccagatataacccaagccattcaggaggaagacaag
aaaagagttcctgtaactcctgcagtcaatcgtgacaataaacctacctgttacactaaa
gcagaaatttccaggctctctgcatcgcagattcgaaatcttaatcctgtgtttggggga
tcgggaccagctctgacaggacttcggaatctagggaacacttgctacatgaattccata
ttacagtgtctgtgcaatgcacctcacctggctgagtatttcaacagaaacttgtatcaa
gctgatattaacaggtcaaatttcctggggcataaaggtgaagtggctgaagagtttggt
gtaataatgaaagctttatgggcaggacagtataaatatatcagtccaaaagacttcaaa
attacaattgggaagattaatgaccaattttcaggatacagccaacaggactcccaagaa
ttgcttctctttctaatggatggcttgcatgaagacctaaataaagctgacaacaggaaa
agatacaaggaagaaaataacgatcaccttgatgactcaagtgcagcagaaatagcctgg
cacaaacacaaacagctcaacgagtccatcattgtggcactcttccaaggccagttcaaa
tccaccgtgcagtgtctgacgtgtcacaagaggtcccgaaccttcgaggctttcatgtat
ctgtcactgccacttgcatcctccagcaaatgcactctgcaggaatgccttagattgttc
tccaaagaagaaaagctcactgataacaatagattttactgtagccattgcaaaactcga
agggattctttgaaaaaaatagaaatttggaaattaccacctgttcttcttgtgcacttg
aaacgattttcctatgatggaagatggaaacaaaagcttcaaacttcagtagattttcca
ctggaaactcttgacctctctcagtatgttattggtccaaagacttccttgaagagatac
aatctgttctcagtatcgaatcattacggtgggctggacggggggcactacacagcctac
tgcaaaaatgcttcaaaacagcgctggtttaagtttgatgaccatgaagtgtctgagatc
tcggcgtcctcggtgaagtcctcagctgcttacattctcttttatacttcctatgaacag
cgagcagtagatatggccacgtaa

DBGET integrated database retrieval system