KEGG   Taeniopygia guttata (zebra finch): 100222567Help
Entry
100222567         CDS       T01082                                 

Definition
alcohol dehydrogenase 1-like
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100222567
  Lipid metabolism
   00071 Fatty acid degradation
    100222567
  Amino acid metabolism
   00350 Tyrosine metabolism
    100222567
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100222567
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100222567
   00982 Drug metabolism - cytochrome P450
    100222567
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100222567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 376 aa AA seqDB search
MATAGKVIRCRAAVAWAPGKPLSVEEVEVAPPKAGEVRIKLVATGICCTDEHLLQGCFPS
AEFPVIPGHEGAGIVESAGEGVSSVKPGDKVIPLCLPQCGECSFCQNPESNYCQKTHLSE
PQNLLPDKTSRFTCKGKQIHHYLWISTFAEYTVVPEYAVAKIDAAAPLDKVCLIACGFST
GYGAAINTAKVKPGSTCAIFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKARELGAT
DCINPRDFKKPIQEVLTEMTGQGVDYSFEAIGHADTMIAALASCNASTGVCVMVGELDSG
AKISTDPVLLLTGRTWKGTLLGGWKTRECIPKLVSSYLEGKFNSDLLITHTLPFAKVNEG
FELLRAGKSIRTVLLF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggccactgcgggaaaagttatcaggtgcagggctgctgttgcctgggccccaggcaaa
ccactgtctgttgaggaggtggaagttgcacccccaaaggcaggggaagtccggatcaag
cttgtggcaacaggcatctgttgcacagatgaacaccttctgcaaggctgctttcccagt
gcagaattccctgttatccctggccatgaaggagctggaattgtggaaagcgctggagaa
ggagtgtcctctgtgaaaccaggtgacaaagtgatcccactttgcctccctcagtgtggg
gaatgcagcttctgccagaatcctgaatccaactactgccagaagacccatttatctgaa
ccacaaaacctgctgccagacaagaccagccgcttcacttgcaaagggaagcagatccac
cactacctgtggatcagcacctttgcagaatacactgtggtcccagaatacgccgttgcc
aagatagatgctgcggcacctctggacaaagtctgcttgattgcctgtgggttttccaca
ggctatggggctgccatcaacacagccaaggtaaaaccaggctccacctgtgccatcttt
ggcctcggaggagttggcctctctgttgtcatgggctgcaaggcagctggagctgcccgc
atcattgccgtggacatcaacaaggacaagtttgccaaggccagggagctgggagccact
gactgcatcaaccctcgagacttcaagaagcccatccaggaggtgctcactgagatgacc
gggcagggtgtggactactcctttgaggccatcgggcacgcggacaccatgattgctgcc
ttggcttcctgcaatgccagcactggtgtctgtgtgatggttggagaactggattctggt
gcaaagatttccactgatcctgtgcttctgctgactgggcgtacatggaaggggactttg
cttggaggctggaagacgagagaatgtatccccaaattagtttccagctacttggagggg
aaattcaattcagacttgctgatcacacacacgctgccattcgctaaagtgaacgaggga
tttgagttgttacgtgcaggaaaaagtatccgcactgtcctgctcttctga

DBGET integrated database retrieval system