KEGG   Taeniopygia guttata (zebra finch): 100222694Help
Entry
100222694         CDS       T01082                                 

Definition
histone acetyltransferase KAT7-like
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
27
AA seq 425 aa AA seqDB search
MAAVHPRPNGHLPARALFLPSPIAPRPPPHGWRCRGSKPRADWLLFAVNHARRRPAFLLL
ELLLVGLPFVPAYARCDWLGPARLRWGQNKAARGPRSRHRREAPPPPLMAATPLPAPLTA
AAIAAPSPRPGKGGRNAGSSSDGTEDSDFSTDPEHTDSSESDGTSRRSARVTRSSARLSQ
SSQDSSPVRNPPAFGPDEPVYSTRRVTRSQQQPAPVTPKKYPLRQTRSSGSETEQAVDFS
DRDTKNAADHDESPPRTPTGNAPSSESDIDISSPNVSHDESLAKDMSMKDSGSDLSHRPK
RRRFHESYNFNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQI
EERMLAHRQDDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYG
NTREP
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgtccatccccgccccaacggtcacctccccgcgcgagccttgttcctccct
tcccccatcgcgccgcggcctcccccccacggttggcgttgccgtgggagcaagcctcgc
gctgattggctgctgttcgccgtcaatcacgcgaggcgtcggcccgcctttttgctcctc
gagctgctattggtaggtctcccttttgtccccgcctacgcgcgctgtgattggctgggg
ccggcgcggctccgctgggggcaaaacaaagcggcgcgggggccgcgctcccgccaccgg
cgcgaggcgcccccccctcccctcatggcggccacgcccctccccgctcccctcacggcc
gccgccatcgccgccccctcaccacggcctggaaaagggggaaggaacgcgggcagcagc
tcggatggcaccgaggactcggatttctccacggaccccgagcacacggacagctccgag
agcgacggcacctcccgcagatctgcccgcgtcacccgctcctcggcccggctcagccag
agctcccaggactccagcccggtgcggaacccgccggcctttgggccagacgagccggtg
tactccacacggagggtgacccgcagccagcagcagccagctcctgtcacccccaagaag
tacccgctgcgacagacccgctcctccggctccgagaccgagcaggccgtggacttctcg
gacagagacaccaagaacgcggcggatcacgacgagtcgccgccccgcacccccacgggg
aacgcgccctcctcggagtccgacatcgacatctccagccccaacgtgtcccacgacgag
agcctggccaaggacatgtccatgaaggactcgggcagcgacctctcccaccggcccaag
cgccgccgcttccacgagagctacaacttcaacatgaagtgtcccactcccggctgcaac
tccctgggacacctgaccgggaagcacgagcgccacttctccatctcgggctgccctctc
taccacaacctgtcagcagatgagtgcaaggtgcgagcgcagagccgggacaagcagatt
gaggagcggatgttggcccacaggcaggatgacaacaacaggcacgccaccaggcaccag
gcccccacagagaggcagctgcggtacaaggagaaggtggctgagctcaggaagaagagg
aactcggggctcagcaaggagcagaaggagaaatacatggagcacaggcaaacctatggc
aacaccagggagcct

DBGET integrated database retrieval system