KEGG   Taeniopygia guttata (zebra finch): 100222807Help
Entry
100222807         CDS       T01082                                 

Gene name
WHSC1
Definition
(RefSeq) Wolf-Hirschhorn syndrome candidate 1
  KO
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100222807 (WHSC1)
Enzymes [BR:tgu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100222807 (WHSC1)
Chromosome [BR:tgu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100222807 (WHSC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 1365 aa AA seqDB search
MDFSIKRSSQLLTQKINCIKMKQVPEILGNTNGKPQNCEVNRECSVYLGKAQLSATLQEG
VMQKYNGHETLPFIPADKLKDLTSRVFNGESGAQDAKLRFEPQEIKGVGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDNGADVSQSEENEQKPVNKERRSRKRSIKYDSLLE
QGLVETALVSKTSSTTEKKAPAKRDSTQSTIKEEKVHLLKYNIGDLVWSKVSGFPWWPCM
VSADPVLHAYTKLKGQKKNFRQYHVQFFGDAPERAWIFEKSLVPFKEKDQFEQLCQDSAR
QALNKSEKIKMLKPVSGKLRPQWEMGVKQASEAVAMPVEERKAKYTFIYVRDRPHLNPRV
AKEVGIAVEPLEEMDESCYSSEETTPNLKSMKESGIPSKRRRRTSKLSAADDMQESSQLE
DKNTTPQKSSEQAESKRGIGSPLNRKKTPASTPRSRKGDAVSQFLVFCQKYRDEVVAEHP
DASSEEIEELLESQWNMLSEKQKARYNTKFAIVTSPKSEEDSGSSLKNIGEAKRKVFQDS
PKRRSRSRSNLHGNKRNQKKRTKEPTEDFEVQEAPRKRLRMDKQNNRKRETSNDKTAKTN
SSKVTETSSSQKNQSATKNLSDACKPLKKRNRASAAESSTLAFSKSSSPSASLTENEISD
GQGDERSESPYESADETQTEVSISSKKSERGVGTKKEYVCQLCEKTGDLLLCEGLCYRAF
HVSCLGLSGRPAGKFICSECTSGVHTCFVCKERKADVKRCVVSHCGKFYHEACVKKFHLT
VFENRGFRCPLHSCLSCHVSNPSHPRISKGKMMRCVRCPVAYHAGDVCIAAGCAVIASNS
IVCTNHFTAMKGKSHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWYCN
DCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYW
THQARVFPYMEGDRGSRYQGIKGIGKVFKNALQEAETRFREIKLQREAKETQESERKPPP
YKHIKVNKPCGKVQIYTADISEIPKCNCKPTDENPCGFDSECLNRMLMYECHPQVCPAGE
RCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIKKGEFVNEYVGELIDEEECMARIKYAH
ENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIP
AGTELTFNYNLDCLGNEKTVCKCGAPNCSGFLGDRPKNSSTNASEEKGKKTKKRTRRRRT
KNEGKKESEDDCFRCGDGGQLVLCDRKSCTKAYHLSCLGLVKRPFGKWECPWHHCDVCGK
PSVSFCHFCPNSFCKEHQDRTVLNSMLNGQLCCSEHVLGVVMLAS
NT seq 4098 nt NT seq  +upstreamnt  +downstreamnt
atggactttagcatcaaaagaagttctcaactgttaactcaaaaaattaactgcatcaaa
atgaagcaggtaccagagatccttggaaataccaatgggaaacctcagaattgtgaagtg
aatcgtgaatgttctgtctacttgggcaaagcacaactttctgccactctacaggaaggt
gtcatgcaaaaatataatggccacgagactcttccatttattccagctgataaattgaaa
gatctgacctctcgggtgtttaatggcgagtccggggcccaggatgccaagctgcgcttt
gaacctcaggaaataaagggagttggaacaccccccaacactactcctatcaagaatggc
tctccagaaataaagctgaaaatcactaaaacctacatgaacgggaagcctctatttgaa
tcctccatttgtggagacaatggtgcagatgtgtctcagtcggaggaaaatgaacaaaag
ccagtaaacaaggagaggagaagcaggaaaagaagcataaaatatgactccttacttgag
cagggtcttgttgaaacagcgttagtatcaaagacttcaagcaccactgaaaagaaggct
cctgctaagagagattcaactcaaagtaccatcaaagaggaaaaagtccatctgttgaag
tataatataggagatctagtgtggtcaaaagtgtctggcttcccatggtggccgtgtatg
gtttctgctgatcctgttctccatgcctacactaaactaaaaggacagaaaaagaatttt
cgtcagtatcacgttcagtttttcggagatgccccagagcgagcctggatatttgagaag
agcctggtgcccttcaaagaaaaagaccagtttgagcaattatgccaagatagtgcaaga
caagccctcaataaatcagagaaaataaagatgctgaagccggtgtcgggaaagctgcgg
ccgcagtgggagatgggtgtgaaacaagccagtgaagcggtggccatgccagtggaggag
cgcaaggccaagtacaccttcatctatgtcagggacagacctcatctgaatcctcgagtg
gcaaaggaggttggcattgctgtggagcccttggaggagatggatgagtcgtgctactca
agtgaagaaaccactcccaatctgaaatcaatgaaggagtctggcattcctagcaagagg
aggagaaggacatcaaaactctctgctgctgatgatatgcaagagagcagtcagttggag
gataagaatactactcctcagaagtcatctgaacaggcagaatccaaaagagggataggc
tcccctctcaatagaaagaaaacgccggcatctactccacgaagcagaaagggcgatgca
gtatctcagtttttggtcttttgtcagaagtacagagatgaggtggttgctgaacatcca
gatgcttcaagtgaggagattgaagagctgctggaatcgcagtggaacatgcttagtgaa
aaacagaaagctcgctataacacaaagtttgccatagtgacctctcccaaatctgaagaa
gactccggttcatcattgaagaatattggagaggccaaacgtaaagtgtttcaagactca
cctaaaaggagatcaagatccagaagtaatttacatggaaataaaagaaaccaaaaaaag
aggacaaaggagcctacagaagattttgaagttcaggaggcacctaggaaaagactcagg
atggataaacagaataatcggaagagggagacaagcaatgacaaaacagcaaaaacaaac
tcttctaaggtcacagaaacctcctcttcacaaaagaaccagtcagcaacgaaaaatctg
tctgatgcatgtaaacctctgaagaagcgaaatcgggcttcagcagcagaatcttcaact
cttgcttttagcaagagttcatctccttcagcttccttaactgagaatgagatctctgat
ggccaaggagatgagcgctcagagtccccctatgaaagtgctgatgagactcagactgaa
gtgtctatatcatccaaaaaatctgagcgaggagtgggaacaaaaaaagaatatgtgtgt
cagctgtgtgaaaaaacaggtgatctcctgctgtgtgaaggactttgctatcgagctttt
catgtaagctgccttgggctctctggaagaccagcaggaaaattcatttgtagtgaatgt
acatcaggtgtgcacacctgtttcgtgtgtaaggagagaaaggcagatgtgaaacgctgt
gttgtgtctcactgtggcaaattctaccacgaagcttgtgtgaaaaaatttcatctcact
gtgttcgagaacagggggtttcgatgtcctctccacagctgcctcagttgtcatgttagt
aacccctcacatccacgaatttcaaaagggaagatgatgcgctgcgtgcgctgccccgtc
gcgtaccacgccggcgacgtttgcatcgccgcgggatgcgccgtcatcgcctccaacagc
atcgtgtgcaccaaccacttcactgccatgaaggggaagagccaccacgcccacgtcaat
gtcagctggtgctttgtgtgctccaaaggtggaagtttgctgtgctgcgagtcctgccca
gcagcctttcaccctgactgcttaaacatcgaaatgccagatgggagctggtactgcaac
gactgcagggcgggcaagaagctccatttccaggatattatttgggttaaactgggaaat
tacagatggtggcctgcagaagtttgccatccgaaaaacgttcccccaaatatccagaaa
atgaagcatgaaatcggagaatttcctgtgtttttctttggttctaaggattactattgg
acgcaccaagcacgggtgttcccttacatggagggagacagagggagtagataccaaggg
atcaaaggaattggaaaagtcttcaaaaatgctttgcaagaagctgaaactcgatttcga
gaaataaaactacagcgagaagccaaagaaacccaggagagtgaacgtaaacctccccca
tacaagcatattaaggtgaacaaaccttgtggcaaagtgcagatatacactgctgacata
tctgagattcccaagtgcaactgcaagcccacggatgaaaacccctgcggctttgactcg
gagtgcctcaatcggatgctgatgtacgagtgccacccgcaggtgtgcccggcgggggag
cgctgccagaaccagtgcttcaccaagcgccagtaccccgagacaaagatcatcaaaacc
gatggcaagggctggggactggttgccaagagggacattaaaaagggggagtttgtcaac
gagtatgtgggagagctgattgatgaagaggagtgtatggcaagaatcaaatatgcacat
gaaaatgacatcacccacttctatatgcttactattgataaggaccgtattattgatgct
ggccccaaaggaaactattcccggtttatgaatcacagctgccaaccaaattgtgaaact
ctgaagtggacagtgaatggagacactcgtgttgggctctttgctgtgtgtgacattcct
gcagggacagagctgacttttaattacaaccttgactgtctgggcaatgaaaaaacagtc
tgcaaatgtggtgccccaaactgcagtggatttcttggggacagaccaaagaattcttcc
actaatgcctcagaagaaaaaggaaaaaagaccaaaaagagaacacggagacgcagaacg
aaaaatgaagggaagaaagaatctgaagatgattgtttccgttgtggtgatggaggccag
ctggtgttgtgtgacaggaaatcttgtactaaagcctatcatctctcctgccttggtttg
gtgaaacgtccttttgggaagtgggagtgtccttggcaccactgtgatgtttgtggcaaa
ccttctgtttctttctgccacttttgcccaaactctttctgcaaggagcaccaagacagg
acagtgctaaattccatgttgaacggacagttatgctgctctgaacatgttctcggggtg
gttatgcttgcctcttga

DBGET integrated database retrieval system