KEGG   Taeniopygia guttata (zebra finch): 100222852Help
Entry
100222852         CDS       T01082                                 

Gene name
PLCE1
Definition
(RefSeq) phospholipase C, epsilon 1
  KO
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100222852 (PLCE1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100222852 (PLCE1)
   04070 Phosphatidylinositol signaling system
    100222852 (PLCE1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100222852 (PLCE1)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100222852 (PLCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 2294 aa AA seqDB search
MTSEEMTASVLFSVVQGKVIAAQSAGDENTENALDTSVIRRHTASSGRQTTHNLSYLHRL
EEKSLQGSVPKIFPLAKEQLANDKSNENFWERNSSISDSVEFLNINCNIVQKNYKSNISC
SQLYQSCAPLAGEEACLETGIPVSLERAMLAEIQLKMNGPSLRSQTAVNKNDSSDPDKVA
FFHLHCASERNISKALCGLHNSFILDDCLQPVSDGDGNTTGSPACTCSIMQLTNNCENKN
GQQLYEDALRDKYLCLERAPRKVKVACSGHSFCGSNFTGRMPSKPFLSHFEDCNDNCEEE
LEEDFFRNKKERSTLLIRRFCKNDKEVKKSVYTGTRAIFRTLPLGHIGTVAWNYVERRRN
NCGMKLSRITTEQLTIIQTLIKWKCNSSPEKSLWYEIFSTVTEEEEGAEDIFEYIPHLLR
KLPTSVTDCIYKGDGFCVKPCVTGAYCQYRATLQRTALSNYITGALLEATTSLGARSGLL
NIFGGSTGRTMLKERQACTSMAGSSILPSSVAGISKELLELQHLIQFPEEVASILTEQEQ
ELYRKVLPIDYLCFLTRDLGSAECQSKLPSLKASISATILSSPNGEHNAVEDLVTRFNEV
SSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMD
QSDIETMRSLKDAMAQHESSSEYRKVVNRALNIPGCKVVPFCGVFLKELCEVLDGASSLI
RLCPRYNSQDETLEFVSDYSGQDNFLQRVGQDGLNNPEKDPTTNKFFQTIRSCTRSLESE
EGEDNVSEGSNSRKNSLKDKNCYQFLIGDLSDSESDIFEQLKEWDTSSTEEQQKAFCHGI
ELIPWYVLSIRADVHQFLQQGATVIHYDQDTHLSARCFLQLQPDNSTLTWTKPTTVCPAN
AKAKLGVLGNTAELGKYQFLGNTGLVEGFLDLFSAKAVYMGHSGIDMHTVCVQNKLCNMS
LEENGITLLYGLQTTDNKLLHFVAPKYTARMLYDGLLELTKAVRKMRRFPDQRLQWLRKQ
YVSLYQEDGRFEGPTLAQAVELFGGRRWSARSTGTGSLTKSTEKPNMQRNNTLGISTAKK
KKKVLIRGESGEATDDEMATRKAKSCKEYRNRSGSDPQDIDEQEEPDQNIIINASPSNNL
PSRRAHSLTASGSPNLGATSSSPARPVSSPVISSSKSQSSTWSSSSWHGRVKGGMKGFQN
FMVSDSNMTFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGLDPAPLYTNLKIDENSS
GFQPDLDLLTRNVSDLGLFIKSRQQLSDNQRQISDAIAAASIVTNGTGVESTSLGVFGVG
IQQLNDFLVNCQGEHCTYDEILSIIQKFEPSVNMCQQGLLSFEGFARFLMDKDNFASKND
ESQENIEDLQFPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDD
GMPIIYHGHTLTTKISFKEVVEAIERNAFITSDMPVIISIENHCSLPQQRKMAEIFKNVF
GDKLVTKFLFESDFSDDPMLPSPGQLRRKILLKNKKLKAHQTPVDILKQKAHQLAHLQAQ
ASNGASNPTPTNEEEEDEEDEYDYDYESLSDDNILEDRPENKLSSDKLQFEYNEENAKRL
KKADCATYNNKGKVYDMELGEEFYLPQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNPS
GSSRGKERKSRKSIFGNNPGRLSPGESAALAKASGKGPFDAMRQTWEDPCSPYNSPASLS
AIIRTPKCYHISSLNENAAKRLCRRYSQKLIQHTTCQLLRTYPAATRIDSSNPHPLIFWL
HGVQLVALNYQTDDLPLQLNAAMFEANGGCGYVLKPPVLWDKNCSMYQHFCPLERDLDNK
EPAIYSLTIVSGQNVCPSNSTGSPCIEIDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLF
RVHFEDLVFLRFAVVENNCSAVTAQRIIPLKALKRGYRHVQLHNLHNETLEISSLFINSR
RMEESPSGNSLPASMLFSQGERKAAVTYKVTVHGIPGPEPFTVFSVSAGTTAAQLLHQIL
ATIKGTESCAADYFLMEEKSFISKEKSECRKPPFQRVIGPEEGLVQLLNSWFPEEGYVGR
IIFKTREENLNERNVFQEAKEEAAISSEDDSFFVQVHDVSPEQPRTVIKAPRLSTAQDVI
QQTLCKAKYSYSILSNPNPSDYVLLEEVTKEPANKKSSTSKPSQRILSDQECVFQAQSKW
KGAGKFILKLKEQVQAARDDKRKGISFTSELKKLTKSSKQYRGFVSPALQGLSDGAQGRE
ERAACAVAFSDTME
NT seq 6885 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgaggagatgacagcgtctgttctcttctctgtggtacagggtaaagtgata
gctgcccagtcagctggagatgaaaatactgaaaatgctttggacaccagtgttataaga
agacatacagccagttcgggaaggcaaaccacacacaatctgtcttacttacacagactt
gaagaaaaaagtcttcagggctcagtgcccaaaatattccctctggccaaagaacaactg
gctaacgacaagagtaatgaaaatttctgggagaggaacagctccatctctgattcagtg
gaatttcttaacattaactgtaacattgtacagaaaaactacaagagcaatatctcctgc
agccagttgtatcaatcgtgtgctcctttagcaggggaagaggcatgcctggaaactgga
attcctgtttctctggaaagagccatgcttgctgaaattcagctgaaaatgaatggacct
tcattaagaagccagacagcagtaaataagaatgacagcagtgatcctgataaagtggcc
ttttttcacttgcattgtgctagtgaaaggaatatatcaaaggctttgtgtggtttacac
aacagcttcattttggatgactgcttgcagcccgtgagtgatggggatggtaacaccact
ggctccccagcctgcacttgcagcataatgcagttgacaaataattgtgagaataaaaat
ggacagcagttgtacgaagatgctttaagggataagtacttatgtctggaaagagcacca
agaaaggttaaagtggcatgctcaggtcacagcttctgtggaagtaactttactggaaga
atgccctcaaagccctttctgagccattttgaggactgcaatgataactgtgaagaagag
ctggaagaggatttttttagaaacaaaaaggaacgttctacattattaataagacgtttc
tgtaaaaatgacaaagaggttaaaaaatcagtttatactggaacaagagcaatttttagg
actttaccattggggcacataggaactgttgcttggaattatgttgagcggaggagaaac
aactgtggcatgaagctttctaggattacaacagaacagctaactataattcagacccta
ataaaatggaaatgtaattccagtcctgagaagtctttatggtatgagatcttcagtaca
gtgacagaagaagaggaaggagcagaagatatttttgaatatattcctcatcttctgaga
aagctcccaacatctgttacagactgtatatacaaaggagatggtttttgtgtaaaacca
tgtgtaacaggtgcttactgtcaatatcgtgccactttacagaggactgcactctctaac
tatataactggtgctttactagaagcaactacatcattaggagcaagaagtggtctttta
aatatctttggaggatcaactggaagaacaatgcttaaagaacgccaagcgtgtacatcc
atggctggctccagcatccttccctccagcgtggccggtatcagcaaggagctgctggag
ctgcagcacctgatccagttcccggaggaggttgccagcattctgaccgagcaggagcag
gagctctaccgcaaagtcttacccatcgactacctctgctttctcaccagggatttgggt
agtgctgagtgtcaaagcaagctgccatctcttaaggcatccatatctgctactattctt
tcttctcccaatggtgaacataatgctgtagaagatcttgtgaccaggtttaatgaggtg
agctcgtgggttacctggctgatcctgactgcaggctctatggaggagaaacgagaagtc
ttctcatatttagtacatgtggcaaaatgctgctggaatatgggcaactacaatgctgta
atggaattcctggcagggctaaggtcaagaaaagttttaaaaatgtggcaatttatggac
cagtctgatattgaaaccatgcgaagtctgaaggatgctatggcacaacatgagtcatca
tctgaatacaggaaagtggtcaaccgggcactcaatattccaggctgtaaagttgttcct
ttctgtggtgtatttttaaaagagctctgtgaagttttggatggagcatcaagcctcatc
agactctgtccacgatataactcccaggatgaaacactagagtttgtttcagattacagt
ggacaagataatttcttacaacgagtaggccaagatggtttaaataatccagaaaaagat
ccaacaacaaacaaattcttccaaactatccggagctgcactcgcagtttggagtctgag
gagggtgaagataatgtcagtgaagggagcaattcaaggaaaaactccttgaaggacaaa
aactgctaccaatttctcataggagacctttcagattctgaaagtgacatatttgagcag
ttgaaagaatgggacacaagttcaacagaagagcagcagaaggctttctgccatgggata
gaactgattccctggtatgtgctgtccatcagggctgacgtccatcagttcttgcagcaa
ggcgcaaccgtaattcattacgaccaggacacgcatctctctgctcgttgctttcttcag
ctccagcctgacaacagtactttgacttggacaaaacccacaacagtttgccctgcaaat
gctaaggcaaaactgggtgtgctgggcaatactgctgagcttggtaaataccagtttctt
ggtaacactggactggtagaaggctttttggacttgttttcagccaaggctgtatatatg
ggacactcgggcattgatatgcacactgtgtgtgttcaaaataagctttgcaatatgtcc
cttgaagaaaatggtataacactactttatggacttcagactactgataataagttgctg
cactttgttgctccaaaatacactgccagaatgctgtatgatggattgctggaattgact
aaagctgtaagaaaaatgaggcgattccctgatcaaagactacagtggctacggaaacag
tatgtcagcctttaccaggaggatggaaggtttgaaggcccgaccttggctcaggctgtt
gagctctttggaggcagacgatggagtgcaagaagcacaggcacgggatctctcaccaaa
agcactgagaagcccaatatgcagagaaacaacactctgggaatcagcacagctaagaaa
aagaagaaagtactcatcaggggtgaaagtggagaggccactgatgatgaaatggcaact
cggaaggcaaaaagctgtaaggaatatcgtaatagaagtggttcagatcctcaagatatt
gatgaacaagaagaaccagatcaaaatattattattaatgcttctccatctaacaacttg
ccatcaagaagagctcactctctgacggcatctggatctcccaacttaggagctacatca
tcttcaccagcgagaccagtctcctctcctgtaatatcatcaagcaaaagtcagtctagc
acatggagcagcagtagctggcatggccgtgtcaaaggaggaatgaagggatttcagaac
ttcatggtgtctgatagtaacatgacttttgtggaatttgtagagctcttcaaatctttc
agtgtccgtagccgcaaggatctgaaagacctttttgatgtttatgctgtgccttgcaat
cgatctggcttagaccctgctccactttatactaatttgaagattgatgaaaatagcagt
ggattccagcctgatttagatttgttgactagaaatgtttcagaccttggtttgttcatt
aagagcaggcagcagctatcagacaaccagaggcaaatatctgatgctattgctgctgcc
agcatcgtaaccaatggtactggagttgaaagcacatcactgggagtatttggagtagga
attcagcagctgaacgacttcctagtgaattgccaaggagaacactgcacctatgatgaa
atcctcagtattatccagaaatttgaacctagtgtgaacatgtgccagcaggggctgcta
tcttttgaaggatttgcaagatttttgatggataaagacaactttgcctccaaaaatgat
gaatcacaggagaatattgaggacttgcagtttcctctctcatattactacatagaatcc
tcacacaatacctaccttactggccatcagcttaaaggggagtcctcagtggagctctac
agccaggttcttttacaaggctgcagaagtgtagaattggattgctgggatggtgatgat
gggatgcccatcatttatcatgggcacactcttactacaaagatctcttttaaggaggtg
gtggaagccatcgagcgcaacgcgttcatcacctccgacatgccggtcatcatctccatc
gagaaccactgctcgctgccccagcagcgcaagatggccgagattttcaagaatgtgttt
ggggataagctggtgacaaagtttttatttgagagtgacttttctgatgatcccatgctg
ccttcccctggccaactgagaagaaaaatcctgcttaaaaacaagaagctgaaagctcat
caaacgccagtggatatattgaaacaaaaggctcatcagctggcacatttgcaagcacag
gctagcaatggtgctagcaaccccacacctaccaatgaagaggaagaagatgaggaggat
gaatatgactatgactatgaatctctctctgatgataatattcttgaagatcgaccagag
aataaattatcaagtgataaactgcagtttgaatataatgaagagaatgccaaacgacta
aagaaggctgattgtgctacttacaataataaaggaaaggtttatgacatggagctgggt
gaagaattctatcttccacaaaataagaaggaaagcagacaaatagccccagagctatca
gatcttgtcatttactgtcaagctgtaaagttcccaggcttgtcaactctaaacccatct
ggctctagcagaggaaaagaaagaaaaagcaggaagtccatttttggcaacaatcctggc
aggctgagccctggggagtcagctgctcttgccaaagcatctggaaaaggtcctttcgat
gcgatgcggcagacctgggaagatccttgctctccttacaactctccagcctccctcagt
gccatcataaggactcccaagtgctatcacatctcgtccctgaatgagaacgctgccaag
cggctctgcaggcgctactcccagaagctgatccagcacaccacctgccagctcctgcgg
acctaccccgctgccacgcgcatcgactcctccaacccccaccccctcatcttctggctc
cacggtgtgcagctcgtggctctgaactaccagacagacgatcttcctctgcaactcaat
gcagcaatgtttgaggctaacggtggctgtggatatgttctgaaacctccagttctgtgg
gataaaaactgttcaatgtaccagcatttttgtccattggaaagagaccttgataataag
gagccagctatatattctttaacaatcgtgtccggccagaacgtttgccccagcaacagc
acgggcagcccctgcatcgagatcgacgtgctggggatgcccctggacagctgccacttc
cgcaccaagcccatccaccgcaacactctcaaccccatgtggaacgagcagttccttttc
cgcgttcacttcgaagatttggtctttctccgctttgcggttgttgaaaataactgctca
gctgtaacagcccagaggatcattcccctgaaagccctgaagagaggctacaggcatgtc
cagctccataacctacacaatgaaacattagaaatttccagtttgttcataaacagtcgg
agaatggaagaaagtccctctggaaacagtctgcctgcatctatgttgtttagccaggga
gaaaggaaagctgccgtgacttacaaagtgacagttcatggaattccaggcccagagcct
ttcactgttttcagtgtgagtgcggggaccacggctgcacagctgctccatcagatcttg
gctaccataaaaggcactgagtcatgcgctgcagactattttctgatggaagagaaaagt
tttatatcaaaagaaaagagcgaatgcagaaaaccaccattccagagagtgattggtcct
gaagaagggctagtgcagcttttaaacagttggttcccagaagaaggatatgttggaaga
attatctttaaaactcgagaggaaaatttaaatgagagaaatgtctttcaagaagcaaag
gaagaagcagccatcagctctgaggatgacagcttctttgttcaggtacatgatgtctcc
ccagagcaaccacgcaccgtgatcaaagctccacgcctcagcacggctcaggatgtcata
cagcagactctctgcaaagccaaatactcctacagcattttgagcaatccaaacccaagt
gattatgtgcttttggaagaggtgactaaagagccagcaaacaaaaagtcttcaacatct
aaaccatctcagaggattctctctgatcaagagtgtgtgtttcaggcccaaagcaagtgg
aagggagcaggaaaatttatccttaagctcaaagaacaggttcaggcagcacgagatgac
aagagaaaaggcatctccttcaccagtgaactgaagaagctgaccaagtcgagtaagcag
taccggggcttcgtgtcgccggcgctgcagggcctgtcggacggcgcccagggcagggag
gagagagccgcctgcgccgtggccttcagcgacaccatggagtag

DBGET integrated database retrieval system