KEGG   Taeniopygia guttata (zebra finch): 100223160Help
Entry
100223160         CDS       T01082                                 

Definition
NAD(P)(+)--arginine ADP-ribosyltransferase 2-like
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100223160
Cellular antigens [BR:tgu04090]
 Proteins
  100223160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 263 aa AA seqDB search
MAVAAVAFGVVPLDMAPNSFDDQYLNCGPAMAAALPALNSSEFQQNEAFAQVWVKATAEW
QKQRSKSSALSPAQAIAVMAYTMNDVYEQFNAAVRTAGKSSQQYRDNFHFKTLHFLLTQA
LQKLRDPKKCWNVCRGAKPVQSTLKVGETVRFGQFASSSLKKYEAQCFEKGAMFEVYTCH
GADIHEFSRYQYEQEVLIPPFETFQVIDVKKESHTMKIVLRSTGNSSNYNCEWLRGGSLP
RNSPHLGGLLLATVAMVVAIGTL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggccgccgtggctttcggtgtggtgcccctggacatggccccgaactccttt
gatgaccagtacctgaactgcggccccgccatggccgcggcgttgccggccctcaacagc
tccgagttccagcagaacgaagcgtttgcccaggtctgggtgaaggccacggccgagtgg
cagaagcagcgctccaaatcatccgctctgtccccggcccaggccatcgccgtcatggcc
tacaccatgaatgatgtgtacgagcagttcaacgcggccgtgcgcacggctggaaaatcc
agccagcaataccgggacaacttccacttcaaaacgctgcatttcctgctgacccaggcc
ctgcagaagctcagagaccctaagaagtgctggaatgtgtgccggggggcgaaacctgtc
cagtccactttgaaagttggcgagacagtccgcttcggtcaattcgcttcatcgtcgctg
aagaaatacgaggctcagtgttttgagaaaggcgcaatgttcgaggtgtacacgtgtcat
ggcgcagacatccatgagttctctcgctatcaatacgagcaggaggtgctgatcccaccc
tttgagacctttcaggtcattgatgtcaagaaggaaagtcacacaatgaaaattgtgctt
cgctccaccgggaactccagcaactacaactgcgagtggctgcgaggtgggagcctcccc
aggaactccccccacctcgggggacttctcctggccaccgtggccatggtggtggccatt
ggaaccctctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system