KEGG   Taeniopygia guttata (zebra finch): 100223290Help
Entry
100223290         CDS       T01082                                 

Gene name
HADHA
Definition
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100223290 (HADHA)
   01212 Fatty acid metabolism
    100223290 (HADHA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100223290 (HADHA)
   00650 Butanoate metabolism
    100223290 (HADHA)
  Lipid metabolism
   00062 Fatty acid elongation
    100223290 (HADHA)
   00071 Fatty acid degradation
    100223290 (HADHA)
   01040 Biosynthesis of unsaturated fatty acids
    100223290 (HADHA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100223290 (HADHA)
   00310 Lysine degradation
    100223290 (HADHA)
   00380 Tryptophan metabolism
    100223290 (HADHA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100223290 (HADHA)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100223290 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100223290 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 719 aa AA seqDB search
MQGVQKDLHNWHRVAFFKACEVNTLSKQLSAEFTDVMNEIWANEAVKSAVLISSKPGSFI
AGADLKTHVSCDIKGDVAVVRFNTPNSKVNTLSKQLSAEFTDVMNEIWANEAVKSAVLIS
SKPGSFIAGADLNMLEACKTAQEVTQLSQDGQKMLEKIEHSPKPVVAAISGSCLGGGLEV
AIACHYRVATKDRKTVLGTPEVLLGLLPGAGGTQRLPKMVGLPAAFDMMLTGRNIRADRA
KKMGLVDQLVEPLGPGVKTPEARTIEYLEEVAIGFARGLANKTVSAKRSRGLMQRLTDYA
MALPFVRQQVYKTVESKVQKQTKGLYPAPLKIIEVVKTGLDQGNDAGYLIEAQSFGQLAV
TKESKALMGLYHGQVHCKKNKFGTPQKEVKTLAVLGAGLMGAGIAQVSVDKGIKTILKDT
TQKGLDRGQQQVYKGLNSKVKKKSLTSFERDSILSNLMGQLDYKGFEKADMVIEAVFEDI
NVKHKVLKEVEAVIPAHCIFASNTSALPISQIAAVSKRPEKVIGMHYFSPVDKMQLLEII
TTDKTSQDTAASAVAVGLKQGKVVIVVKVIGMHYFSPVDKMQLLEIITTDKTSQDTAASA
VAVGLKQGKVVIVVKEGVDPKKVDAISTAFGFPVGAATLIDEVGVDVATHVAEDLGKAFG
PRFGGGSIDLFKLMVQKGFLGRKAGKGFYVYQEGVKNRSVNSGMDEILEKFRVPANPDV
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgcagggggtccagaaggacctgcataactggcatcgtgttgcttttttcaaggcttgc
gaggtgaacaccctgtccaagcagctgagtgcagagttcaccgacgtcatgaacgagatc
tgggccaacgaggccgtcaagagcgccgtgctcatctcctccaagccaggctctttcatt
gctggagcggatctcaaaacccacgtcagctgtgatatcaaaggggatgtcgccgtcgtg
cgcttcaacacaccaaattccaaggtgaacaccctgtccaagcagctgagcgcggagttc
accgacgtcatgaacgagatctgggccaacgaggccgtcaagagcgccgtgctcatctcc
tccaagccaggctctttcattgctggagcggatctcaacatgcttgaagcctgcaagact
gctcaggaagtgactcagctctctcaggatggacagaagatgctggaaaagattgagcac
tccccaaagcctgtggtggctgccatcagtggcagctgcctgggaggagggctggaggtt
gccattgcctgtcactacagagtagcaacaaaggacaggaaaacagtcttgggaacacct
gaagtgttgctgggtctcctgcccggagcagggggtactcaaaggctgccaaagatggtg
ggacttcctgctgccttcgacatgatgctgactggcaggaacatccgtgcagacagagcc
aagaagatggggctggttgaccagctggtggaaccactagggccaggagtgaagactcct
gaagcaagaacaatcgagtacctggaggaggtggccattggctttgccaggggactggcc
aacaagaccgtgtctgccaagagatccagagggctcatgcagaggctaacagactatgcc
atggctcttcccttcgtcaggcagcaagtttacaagacagtggagagcaaagttcaaaag
caaaccaaagggctctaccctgctcctctgaagatcatcgaggtcgtaaaaactggtctg
gatcaggggaatgatgctggatacctcattgaagcccagagctttggccaacttgctgtg
accaaggaatccaaggcactgatggggctctaccacgggcaggtgcactgcaagaagaac
aagtttgggacacctcagaaagaggtcaagactctggctgtgctgggagcggggctcatg
ggagccgggatcgcccaggtttccgtggataagggcatcaagaccatcctgaaggacacc
acacagaagggtctggacagaggccagcagcaggtctacaaggggctgaacagcaaggtg
aagaagaagagcctgacatcatttgagagggactccatcctcagcaacctgatgggccag
ctggactacaagggctttgagaaggcagacatggtcatcgaggccgtgttcgaggacatc
aacgtcaaacacaaagtgctgaaggaggtggaggctgtgatcccagctcactgtatcttc
gccagtaacacctctgccctccccatcagccagatcgctgctgtcagcaagaggcccgag
aaggtgattgggatgcactacttctcccctgttgacaagatgcagctgctggaaatcatc
accacagacaaaacctcccaggacacagctgcttctgctgttgctgttggcctcaaacag
ggcaaagtggtcatcgtggtgaaggtgattgggatgcactacttctcccctgttgacaag
atgcagctgctggaaatcatcaccacagacaaaacctcccaggacactgctgcttctgct
gttgctgttggcctcaaacagggcaaagtggtcatcgtggtgaaggagggtgttgaccca
aagaaggtggatgccatctccacagccttcggcttcccggtgggagcggccacgctgatt
gacgaggttggcgtggacgtggccacgcacgtggccgaggacctgggcaaggcctttggc
cctcgcttcggagggggcagcatcgacctcttcaagctcatggtgcagaaaggcttctta
ggtcgcaaggcagggaaaggtttctacgtgtaccaggagggagtgaagaacaggagcgtg
aattccggcatggatgagatcttggaaaagttcagggtgccagcaaaccctgacgtgtga

DBGET integrated database retrieval system