KEGG   Taeniopygia guttata (zebra finch): 100223290Help
Entry
100223290         CDS       T01082                                 

Gene name
HADHA
Definition
(RefSeq) hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00062  Fatty acid elongation
tgu00071  Fatty acid degradation
tgu00280  Valine, leucine and isoleucine degradation
tgu00310  Lysine degradation
tgu00380  Tryptophan metabolism
tgu00410  beta-Alanine metabolism
tgu00640  Propanoate metabolism
tgu00650  Butanoate metabolism
tgu01040  Biosynthesis of unsaturated fatty acids
tgu01100  Metabolic pathways
tgu01200  Carbon metabolism
tgu01212  Fatty acid metabolism
Module
tgu_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
tgu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
tgu_M00085  Fatty acid biosynthesis, elongation, mitochondria
tgu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100223290 (HADHA)
   00650 Butanoate metabolism
    100223290 (HADHA)
  Lipid metabolism
   00062 Fatty acid elongation
    100223290 (HADHA)
   00071 Fatty acid degradation
    100223290 (HADHA)
   01040 Biosynthesis of unsaturated fatty acids
    100223290 (HADHA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100223290 (HADHA)
   00310 Lysine degradation
    100223290 (HADHA)
   00380 Tryptophan metabolism
    100223290 (HADHA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100223290 (HADHA)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100223290 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100223290 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH
Motif
Other DBs
NCBI-GeneID: 100223290
NCBI-ProteinID: XP_012428409
Position
3
AA seq 692 aa AA seqDB search
MAVNTLSKQLSAEFTDVMNEIWANEAVKSAVLISSKPDRTHVSCDIKGDVAVVRFNTPNS
KVNTLSKQLSAEFTDVMNEIWANEAVKSAVLISSKPGSFIAGADLNMLEACKTAQEVTQL
SQDGQKMLEKIEHSPKPVVAAISGSCLGGGLEVAIACHYRVATKDRKTVLGTPEVLLGLL
PGAGGTQRLPKMVGLPAAFDMMLTGRNIRADRAKKMGLVDQLVEPLGPGVKTPEARTIEY
LEEVAIGFARGLANKTVSAKRSRGLMQRLTDYAMALPFVRQQVYKTVESKVQKQTKGLYP
APLKIIEVVKTGLDQGNDAGYLIEAQSFGQLAVTKESKALMGLYHGQVHCKKNKFGTPQK
EVKTLAVLGAGLMGAGIAQVSVDKGIKTILKDTTQKGLDRGQQQVYKGLNSKVKKKSLTS
FERDSILSNLMGQLDYKGFEKADMVIEAVFEDINVKHKVLKEVEAVIPAHCIFASNTSAL
PISQIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTDKTSQDTAASAVAVGLKQGKVVIVV
KVIGMHYFSPVDKMQLLEIITTDKTSQDTAASAVAVGLKQGKVVIVVKEGVDPKKVDAIS
TAFGFPVGAATLIDEVGVDVATHVAEDLGKAFGPRFGGGSIDLFKLMVQKGFLGRKAGKG
FYVYQEGVKNRSVNSGMDEILEKFRVPANPDV
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgaacaccctgtccaagcagctgagtgcagagttcaccgacgtcatgaacgag
atctgggccaacgaggccgtcaagagcgccgtgctcatctcctccaagccagacagaacc
cacgtcagctgtgatatcaaaggggatgtcgccgtcgtgcgcttcaacacaccaaattcc
aaggtgaacaccctgtccaagcagctgagcgcggagttcaccgacgtcatgaacgagatc
tgggccaacgaggccgtcaagagcgccgtgctcatctcctccaagccaggctctttcatt
gctggagcggatctcaacatgcttgaagcctgcaagactgctcaggaagtgactcagctc
tctcaggatggacagaagatgctggaaaagattgagcactccccaaagcctgtggtggct
gccatcagtggcagctgcctgggaggagggctggaggttgccattgcctgtcactacaga
gtagcaacaaaggacaggaaaacagtcttgggaacacctgaagtgttgctgggtctcctg
cccggagcagggggtactcaaaggctgccaaagatggtgggacttcctgctgccttcgac
atgatgctgactggcaggaacatccgtgcagacagagccaagaagatggggctggttgac
cagctggtggaaccactagggccaggagtgaagactcctgaagcaagaacaatcgagtac
ctggaggaggtggccattggctttgccaggggactggccaacaagaccgtgtctgccaag
agatccagagggctcatgcagaggctaacagactatgccatggctcttcccttcgtcagg
cagcaagtttacaagacagtggagagcaaagttcaaaagcaaaccaaagggctctaccct
gctcctctgaagatcatcgaggtcgtaaaaactggtctggatcaggggaatgatgctgga
tacctcattgaagcccagagctttggccaacttgctgtgaccaaggaatccaaggcactg
atggggctctaccacgggcaggtgcactgcaagaagaacaagtttgggacacctcagaaa
gaggtcaagactctggctgtgctgggagcggggctcatgggagccgggatcgcccaggtt
tccgtggataagggcatcaagaccatcctgaaggacaccacacagaagggtctggacaga
ggccagcagcaggtctacaaggggctgaacagcaaggtgaagaagaagagcctgacatca
tttgagagggactccatcctcagcaacctgatgggccagctggactacaagggctttgag
aaggcagacatggtcatcgaggccgtgttcgaggacatcaacgtcaaacacaaagtgctg
aaggaggtggaggctgtgatcccagctcactgtatcttcgccagtaacacctctgccctc
cccatcagccagatcgctgctgtcagcaagaggcccgagaaggtgattgggatgcactac
ttctcccctgttgacaagatgcagctgctggaaatcatcaccacagacaaaacctcccag
gacacagctgcttctgctgttgctgttggcctcaaacagggcaaagtggtcatcgtggtg
aaggtgattgggatgcactacttctcccctgttgacaagatgcagctgctggaaatcatc
accacagacaaaacctcccaggacactgctgcttctgctgttgctgttggcctcaaacag
ggcaaagtggtcatcgtggtgaaggagggtgttgacccaaagaaggtggatgccatctcc
acagccttcggcttcccggtgggagcggccacgctgattgacgaggttggcgtggacgtg
gccacgcacgtggccgaggacctgggcaaggcctttggccctcgcttcggagggggcagc
atcgacctcttcaagctcatggtgcagaaaggcttcttaggtcgcaaggcagggaaaggt
ttctacgtgtaccaggagggagtgaagaacaggagcgtgaattccggcatggatgagatc
ttggaaaagttcagggtgccagcaaaccctgacgtgtga

DBGET integrated database retrieval system