KEGG   Taeniopygia guttata (zebra finch): 100223331Help
Entry
100223331         CDS       T01082                                 

Definition
deoxycytidine kinase-like
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tgu00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tgu00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 257 aa AA seqDB search
MATPPKRSRTHGRLRKVAVEGNIAAGKSTFVNILKQAGEEWEVVPEPVARWCNVQQSSGD
DCEELSTSQRSGGNVLRMMYEKPERWAFTFQTYACLSRIRAQLGALERKRGDAQNPVVFF
ERSVYSDRYIFAANLYESDCMNETEWTIYQDWHDWMNKQFGSRLALDGIIYLRATPEKCL
NRIYLRGRDEEQEIPIEYLEKLHYKHESWLQHRTLRTNFDYLQEIPILTLDVNEDFKGKK
DRYDHMIDKVKEFLSTL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccgcccaagcgcagccggacccacggccgcctcaggaaagtcgccgtggag
ggcaacatcgctgcagggaaatccacctttgtgaatattctgaaacaagccggtgaggag
tgggaagtggttcccgagcctgtagctagatggtgcaatgtccagcaaagctctggagac
gactgtgaggagctgagcacgtcgcagaggagcggcgggaacgttctgcggatgatgtat
gagaagccggagcgctgggccttcaccttccagacgtacgcctgcctcagcaggatccgg
gctcagctcggcgccctggagcgcaagcgcggggacgcgcagaatcccgtggtgttcttc
gagcgctccgtctacagtgacaggtacatctttgctgctaatttatacgagtctgactgc
atgaacgagaccgagtggacaatttaccaggactggcacgactggatgaataaacagttt
ggctcgaggctggctctggatgggatcatttatctccgagccactcctgagaaatgtttg
aataggatttacttgcgtggaagagatgaggaacaagaaatccccattgaatatctggag
aagcttcactacaaacatgaaagttggctccagcacaggacactgcgaacaaattttgac
tatcttcaggaaattccgattttaacgcttgatgttaacgaagacttcaaaggcaaaaag
gacagatatgatcacatgatcgataaggtcaaggaatttttgagcacgttgtaa

DBGET integrated database retrieval system