KEGG   Taeniopygia guttata (zebra finch): 100223337Help
Entry
100223337         CDS       T01082                                 

Gene name
PCSK2
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 2
  KO
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     100223337 (PCSK2)
Peptidases [BR:tgu01002]
 Serine Peptidases
  Family S8: subtilisin family
   100223337 (PCSK2)
Chaperones and folding catalysts [BR:tgu03110]
 Intramolecular chaperones
  Subtilisin family
   100223337 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 731 aa AA seqDB search
MALRYHCLITPLSLCFCKKRDKGQAAGSPVNRVLPRTGGLGGNSRYFVFAGRGKKLGAGQ
GGEGLAKIFRSPAPTATRVCSTLGVSASPGRPSPGHGQPEGSGHGGTGAGSVGYFPARGA
AYTNHFLVELHDGGQAEAERVAAEHGFAGVRKLPFLESGYFFYHNGLAKARRRRSLQHKL
RLEKDSRVKKAVQQEGFIRRKRGYRDINDIDINMNDPLFTKQWYLINTGQADGTPGLDLN
VAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAKASYDFSSNDPYPYPRYTDDWFNS
HGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSA
SWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMW
TISINSAINDGRTALYDESCSSTLASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAA
PEAAGVFALALEANSQLTWRDMQHLTVLTSKRNQLHDEVHRWRRNGVGLEFNHLFGYGVL
DAGAMVKMAKDWKTVPERFHCVGGSIQEPEKIPPSGKLLLTLTTDACEGKENFVRYLEHV
QAVITVNSTRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGT
WALEIGFVGSQPQRGVLKEWTLMLHGTQSAPYIDQIVKDYQSKLAMSKKEELEEELDEAV
ERSLKSILSKK
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcgctatcactgcttgatcacccccctgtccctttgcttttgcaaaaagagg
gataaaggacaggctgctggcagccctgtgaacagggttctgcctagaacaggaggtttg
gggggaaactccagatattttgtgttcgcgggtcgaggaaagaagctgggcgccggtcaa
ggcggtgagggtcttgccaaaatctttcgttctccagcccctacagccacccgcgtgtgc
tccactttgggagtgtctgcctcccctgggcgaccttctcctgggcatggacagccggag
ggctccgggcacggcgggactggcgctgggagcgttggatacttcccggcccgcggagcc
gcctacaccaaccatttcttggtggagctgcacgacgggggccaggcggaggccgagcgg
gtggcggcggagcacggcttcgctggggtgcggaagctcccttttttagaatctggatac
tttttttatcacaatggtcttgctaaagccaggagaagacgcagccttcaacacaagctt
cgtctggaaaaggactccagggtgaagaaagctgtgcagcaggagggcttcatcagaagg
aaacgaggatacagagacatcaatgacattgacatcaacatgaacgaccctttatttaca
aagcagtggtacctgattaacactggtcaagcagatgggactcctggacttgaccttaat
gtagctgaagcctgggagctgggatacacagggaagggagtaaccataggaattatggat
gatggaattgattatctgcatccagatcttgcatcaaactacaatgccaaagccagctat
gacttcagcagcaatgatccctacccctatccccgctatacagatgactggtttaacagc
cacgggacaaggtgtgctggggaggtgtctgctgctgccaacaacaacatctgcggcgtg
ggggttgcctacaactccaaagtggcaggtattcgcatgctggaccagccgtttatgaca
gacattattgaggcttcctccatcagccacatgcctcaagtcatagatatttatagtgcc
agctggggacccactgataatgggaagactgtggatggacctagagagttaacactgcaa
gcaatggcagatggtgtgaataagggccggggtggaaaaggcagcatctatgtgtgggcc
tctggagatggaggcagctatgatgactgtaactgtgatggttatgcatcgagcatgtgg
accatctccatcaattctgccataaacgatggccggacagctctgtatgatgaaagctgc
tcttcaaccttagcctccacctttagtaatgggaggaagagaaatccagaggctggtgtg
gctacaacagatttgtatggcaactgcaccctgcgtcattcgggcacgtctgcagccgcc
cctgaagcagccggagtgttcgccctggccctggaggctaactcgcagctgacctggaga
gacatgcagcatctgacagtgctcacctccaagaggaaccagctccacgacgaggttcac
aggtggcgtaggaacggcgtcgggctggagttcaaccatttgtttggctacggtgtcctg
gatgcaggggccatggttaagatggcaaaagactggaagacagttcctgagaggttccat
tgtgttggagggtcaatacaggaacccgaaaagataccaccgagtggcaaactgttgctg
acgctgacaacggacgcgtgtgaggggaaggagaactttgtgcggtacctggaacacgtg
caggcggtgataaccgtgaattccacccgccgaggagacctcaacatcaacatgacctcg
ccaatgggcaccaaatccattctgctgagccggcggcccagggatgatgactccaaggtg
ggttttgacaaatggcctttcatgacgactcacacgtggggagaagacccccgaggcacc
tgggctctggagattggctttgttggcagccagccccagcggggcgtgctgaaggagtgg
acgctgatgctgcatgggactcagagtgcaccgtacatagaccaaatcgtaaaagattat
cagtccaaactggccatgtccaagaaggaagagctggaagaagagttagatgaagcagtg
gagagaagcctgaagagcatactgagcaagaagtag

DBGET integrated database retrieval system